DAX1/NR0B1 Antibody


Western Blot: NR0B1 Antibody [NBP1-52821] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related DAX1/NR0B1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DAX1/NR0B1 Antibody Summary

Synthetic peptides corresponding to NR0B1(nuclear receptor subfamily 0, group B, member 1) The peptide sequence was selected from the middle region of NR0B1. Peptide sequence FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NR0B1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DAX1/NR0B1 Antibody

  • AHC
  • AHCH
  • AHX
  • DAX1
  • DAX1DAX-1
  • dosage-sensitive sex reversal
  • DSS-AHC critical region on the X chromosome protein 1
  • GTD
  • HHG
  • NR0B1
  • NROB1
  • nuclear hormone receptor
  • Nuclear receptor DAX-1
  • nuclear receptor subfamily 0 group B member 1
  • nuclear receptor subfamily 0, group B, member 1


NR0B1 is a protein that contains a DNA-binding domain. The protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in its gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC

Publications for DAX1/NR0B1 Antibody (NBP1-52821) (0)

There are no publications for DAX1/NR0B1 Antibody (NBP1-52821).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAX1/NR0B1 Antibody (NBP1-52821) (0)

There are no reviews for DAX1/NR0B1 Antibody (NBP1-52821). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAX1/NR0B1 Antibody (NBP1-52821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DAX1/NR0B1 Products

Bioinformatics Tool for DAX1/NR0B1 Antibody (NBP1-52821)

Discover related pathways, diseases and genes to DAX1/NR0B1 Antibody (NBP1-52821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAX1/NR0B1 Antibody (NBP1-52821)

Discover more about diseases related to DAX1/NR0B1 Antibody (NBP1-52821).

Pathways for DAX1/NR0B1 Antibody (NBP1-52821)

View related products by pathway.

PTMs for DAX1/NR0B1 Antibody (NBP1-52821)

Learn more about PTMs related to DAX1/NR0B1 Antibody (NBP1-52821).

Research Areas for DAX1/NR0B1 Antibody (NBP1-52821)

Find related products by research area.

Blogs on DAX1/NR0B1

There are no specific blogs for DAX1/NR0B1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DAX1/NR0B1 Antibody and receive a gift card or discount.


Gene Symbol NR0B1