DAX1/NR0B1 Antibody (2F12) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related DAX1/NR0B1 Primary Antibodies

Order Details


    • Catalog Number
      H00000190-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DAX1/NR0B1 Antibody (2F12) [DyLight 488] Summary

Immunogen
NR0B1 (NP_000466 361 a.a. - 470 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI
Specificity
NR0B1 - nuclear receptor subfamily 0, group B, member 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NR0B1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DAX1/NR0B1 Antibody (2F12) [DyLight 488]

  • AHC
  • AHCDSS
  • AHCH
  • AHX
  • DAX1
  • DAX1DAX-1
  • dosage-sensitive sex reversal
  • DSS-AHC critical region on the X chromosome protein 1
  • GTD
  • HHG
  • NR0B1
  • NROB1
  • nuclear hormone receptor
  • Nuclear receptor DAX-1
  • nuclear receptor subfamily 0 group B member 1
  • nuclear receptor subfamily 0, group B, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF3075
Species: Hu
Applications: WB, ICC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-47559
Species: Hu
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP1-57033
Species: Hu
Applications: WB
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC

Publications for DAX1/NR0B1 Antibody (H00000190-M02G) (0)

There are no publications for DAX1/NR0B1 Antibody (H00000190-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAX1/NR0B1 Antibody (H00000190-M02G) (0)

There are no reviews for DAX1/NR0B1 Antibody (H00000190-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DAX1/NR0B1 Antibody (H00000190-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DAX1/NR0B1 Products

Bioinformatics Tool for DAX1/NR0B1 Antibody (H00000190-M02G)

Discover related pathways, diseases and genes to DAX1/NR0B1 Antibody (H00000190-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAX1/NR0B1 Antibody (H00000190-M02G)

Discover more about diseases related to DAX1/NR0B1 Antibody (H00000190-M02G).
 

Pathways for DAX1/NR0B1 Antibody (H00000190-M02G)

View related products by pathway.

PTMs for DAX1/NR0B1 Antibody (H00000190-M02G)

Learn more about PTMs related to DAX1/NR0B1 Antibody (H00000190-M02G).
 

Research Areas for DAX1/NR0B1 Antibody (H00000190-M02G)

Find related products by research area.

Blogs on DAX1/NR0B1

There are no specific blogs for DAX1/NR0B1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DAX1/NR0B1 Antibody (2F12) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol NR0B1
Entrez