DAP5 Antibody (3E4.)


Immunocytochemistry/ Immunofluorescence: DAP5 Antibody (3E4) [H00001982-M02] - Analysis of monoclonal antibody to EIF4G2 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF

Order Details

DAP5 Antibody (3E4.) Summary

EIF4G2 (NP_001409 811 a.a. - 889 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DAP5 Antibody (3E4.)

  • aging-associated protein 1
  • DAP-5
  • DAP5AAG1
  • Death-associated protein 5
  • eIF4G 2
  • eIF-4G 2
  • eIF-4-gamma 2
  • eukaryotic translation initiation factor 4 gamma 2
  • eukaryotic translation initiation factor 4 gamma, 2
  • eukaryotic translation initiation factor 4G-like 1
  • FLJ41344
  • NAT1
  • p97


Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Rt, Po
Applications: WB, IP
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for DAP5 Antibody (H00001982-M02) (0)

There are no publications for DAP5 Antibody (H00001982-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAP5 Antibody (H00001982-M02) (0)

There are no reviews for DAP5 Antibody (H00001982-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DAP5 Antibody (H00001982-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DAP5 Products

Bioinformatics Tool for DAP5 Antibody (H00001982-M02)

Discover related pathways, diseases and genes to DAP5 Antibody (H00001982-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAP5 Antibody (H00001982-M02)

Discover more about diseases related to DAP5 Antibody (H00001982-M02).

Pathways for DAP5 Antibody (H00001982-M02)

View related products by pathway.

PTMs for DAP5 Antibody (H00001982-M02)

Learn more about PTMs related to DAP5 Antibody (H00001982-M02).

Research Areas for DAP5 Antibody (H00001982-M02)

Find related products by research area.

Blogs on DAP5

There are no specific blogs for DAP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DAP5 Antibody (3E4.) and receive a gift card or discount.


Gene Symbol EIF4G2