DAN/NBL1 Antibody (1G5)

Images

 
Western Blot: DAN/NBL1 Antibody (1G5) [H00004681-M02] - Analysis of NBL1 expression in transfected 293T cell line by NBL1 monoclonal antibody (M02), clone 1G5.Lane 1: NBL1 transfected lysate(19.3 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DAN/NBL1 Antibody (1G5) Summary

Immunogen
NBL1 (NP_005371, 21 a.a. - 130 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. INKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEG
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NBL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DAN/NBL1 Antibody (1G5)

  • DAN domain family member 1
  • DAN
  • DAND1
  • MGC8972
  • NBL1
  • neuroblastoma suppressor of tumorigenicity 1
  • neuroblastoma, suppression of tumorigenicity 1
  • Protein N03
  • suppression of tumorigenicity 1
  • Zinc finger protein DAN

Background

This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
AF2009
Species: Hu
Applications: WB, IHC
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56883
Species: Hu
Applications: IHC, IHC-P
AF2069
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut

Publications for DAN/NBL1 Antibody (H00004681-M02) (0)

There are no publications for DAN/NBL1 Antibody (H00004681-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAN/NBL1 Antibody (H00004681-M02) (0)

There are no reviews for DAN/NBL1 Antibody (H00004681-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAN/NBL1 Antibody (H00004681-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DAN/NBL1 Products

Bioinformatics Tool for DAN/NBL1 Antibody (H00004681-M02)

Discover related pathways, diseases and genes to DAN/NBL1 Antibody (H00004681-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAN/NBL1 Antibody (H00004681-M02)

Discover more about diseases related to DAN/NBL1 Antibody (H00004681-M02).
 

Pathways for DAN/NBL1 Antibody (H00004681-M02)

View related products by pathway.

PTMs for DAN/NBL1 Antibody (H00004681-M02)

Learn more about PTMs related to DAN/NBL1 Antibody (H00004681-M02).
 

Research Areas for DAN/NBL1 Antibody (H00004681-M02)

Find related products by research area.

Blogs on DAN/NBL1

There are no specific blogs for DAN/NBL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DAN/NBL1 Antibody (1G5) and receive a gift card or discount.

Bioinformatics

Gene Symbol NBL1
Entrez
Uniprot