Recombinant Human DAAM1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DAAM1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human DAAM1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL

Protein/Peptide Type
Partial Recombinant Protein
Gene
DAAM1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DAAM1 Protein

  • disheveled-associated activator of morphogenesis 1
  • dishevelled associated activator of morphogenesis 1
  • dishevelled-associated activator of morphogenesis 1
  • KIAA0666FLJ41657

Background

DAAM1 - dishevelled associated activator of morphogenesis 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24748
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-88460
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24536
Species: Hu, Mu
Applications: WB
NBP2-24724
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB
NB600-230
Species: Hu
Applications: WB
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP1-94174
Species: Hu
Applications: WB, IHC, IHC-P
AF7164
Species: Hu
Applications: WB
NBP1-83900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP1-87933
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24615
Species: Hu
Applications: WB, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00023002-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DAAM1 Partial Recombinant Protein (H00023002-Q01) (0)

There are no publications for DAAM1 Partial Recombinant Protein (H00023002-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAAM1 Partial Recombinant Protein (H00023002-Q01) (0)

There are no reviews for DAAM1 Partial Recombinant Protein (H00023002-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAAM1 Partial Recombinant Protein (H00023002-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAAM1 Products

Bioinformatics Tool for DAAM1 Partial Recombinant Protein (H00023002-Q01)

Discover related pathways, diseases and genes to DAAM1 Partial Recombinant Protein (H00023002-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAAM1 Partial Recombinant Protein (H00023002-Q01)

Discover more about diseases related to DAAM1 Partial Recombinant Protein (H00023002-Q01).
 

Pathways for DAAM1 Partial Recombinant Protein (H00023002-Q01)

View related products by pathway.

PTMs for DAAM1 Partial Recombinant Protein (H00023002-Q01)

Learn more about PTMs related to DAAM1 Partial Recombinant Protein (H00023002-Q01).
 

Research Areas for DAAM1 Partial Recombinant Protein (H00023002-Q01)

Find related products by research area.

Blogs on DAAM1

There are no specific blogs for DAAM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RhoA Antibody
NB100-91273
DAAM1 Antibody
NBP2-24623
FMNL2 Antibody
NBP2-24748

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DAAM1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DAAM1