D4-GDI/RhoGDI2 Antibody

Images

 
Western Blot: D4-GDI/RhoGDI2 Antibody [H00000397-D01P] - Analysis of ARHGDIB expression in mouse spleen.
Western Blot: D4-GDI/RhoGDI2 Antibody [H00000397-D01P] - Analysis of ARHGDIB expression in Jurkat.
Western Blot: D4-GDI/RhoGDI2 Antibody [H00000397-D01P] - Analysis of ARHGDIB expression in transfected 293T cell line by ARHGDIB polyclonal antibody.Lane 1: ARHGDIB transfected lysate(23.00 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

D4-GDI/RhoGDI2 Antibody Summary

Immunogen
ARHGDIB (NP_001166.3, 1 a.a. - 201 a.a.) full-length human protein. MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Specificity
ARHGDIB - Rho GDP dissociation inhibitor (GDI) beta,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGDIB
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for D4-GDI/RhoGDI2 Antibody

  • ARHGDIB Rho GDP dissociation inhibitor (GDI) beta
  • D4
  • GDIA2
  • GDID4
  • LYGDI
  • Ly-GDI
  • RAP1GN1
  • RhoGDI2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00001815-R02
Species: Hu
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00000397-D01P
Species: Hu, Mu
Applications: WB

Publications for D4-GDI/RhoGDI2 Antibody (H00000397-D01P) (0)

There are no publications for D4-GDI/RhoGDI2 Antibody (H00000397-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for D4-GDI/RhoGDI2 Antibody (H00000397-D01P) (0)

There are no reviews for D4-GDI/RhoGDI2 Antibody (H00000397-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for D4-GDI/RhoGDI2 Antibody (H00000397-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional D4-GDI/RhoGDI2 Products

Bioinformatics Tool for D4-GDI/RhoGDI2 Antibody (H00000397-D01P)

Discover related pathways, diseases and genes to D4-GDI/RhoGDI2 Antibody (H00000397-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for D4-GDI/RhoGDI2 Antibody (H00000397-D01P)

Discover more about diseases related to D4-GDI/RhoGDI2 Antibody (H00000397-D01P).
 

Pathways for D4-GDI/RhoGDI2 Antibody (H00000397-D01P)

View related products by pathway.

PTMs for D4-GDI/RhoGDI2 Antibody (H00000397-D01P)

Learn more about PTMs related to D4-GDI/RhoGDI2 Antibody (H00000397-D01P).
 

Research Areas for D4-GDI/RhoGDI2 Antibody (H00000397-D01P)

Find related products by research area.

Blogs on D4-GDI/RhoGDI2.

D4-GDI (GDP dissociation inhibitor, RhoGD12)
The D4-GDI protein is a negative regulator of the Ras-related Rho family of small molecule "molecular switch" GTPases. The Rho GTPases modify cell structure and architecture via rapid changes to the actin cytoskeleton and cell membrane. M...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our D4-GDI/RhoGDI2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGDIB
Entrez
Uniprot