D2HGDH Antibody

Images

 
Western Blot: D2HGDH Antibody [NBP2-84755] - WB Suggested Anti-D2HGDH Antibody. Titration: 1.0 ug/ml. Positive Control: PANC1 Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

D2HGDH Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human D2HGDH. Peptide sequence: QESPFYVLIETSGSNAGHDAEKLGHFLEHALGSGLVTDGTMATDQRKVKM The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
D2HGDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for D2HGDH Antibody

  • D-2-hydroxyglutarate dehydrogenase
  • EC 1.1.99
  • EC 1.1.99.-
  • FLJ42195
  • MGC25181
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22166
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04540
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-75487
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-48748
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87122
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81990
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-83530
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-59409
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB

Publications for D2HGDH Antibody (NBP2-84755) (0)

There are no publications for D2HGDH Antibody (NBP2-84755).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for D2HGDH Antibody (NBP2-84755) (0)

There are no reviews for D2HGDH Antibody (NBP2-84755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for D2HGDH Antibody (NBP2-84755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional D2HGDH Products

Bioinformatics Tool for D2HGDH Antibody (NBP2-84755)

Discover related pathways, diseases and genes to D2HGDH Antibody (NBP2-84755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for D2HGDH Antibody (NBP2-84755)

Discover more about diseases related to D2HGDH Antibody (NBP2-84755).

Research Areas for D2HGDH Antibody (NBP2-84755)

Find related products by research area.

Blogs on D2HGDH

There are no specific blogs for D2HGDH, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our D2HGDH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol D2HGDH