Cytosolic Sulfotransferase 4A1/SULT4A1 Recombinant Protein Antigen

Images

 
There are currently no images for Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cytosolic Sulfotransferase 4A1/SULT4A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SULT4A1.

Source: E.coli

Amino Acid Sequence: GEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SULT4A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81770.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Cytosolic Sulfotransferase 4A1/SULT4A1 Recombinant Protein Antigen

  • Brain sulfotransferase-like protein
  • BRSTL1
  • BR-STL-1
  • Cytosolic Sulfotransferase 4A1
  • EC 2.8.2.-
  • hBR-STL
  • hBR-STL-1MGC40032
  • nervous system cytosolic sulfotransferase
  • Nervous system sulfotransferase
  • NST
  • ST4A1
  • sulfotransferase 4A1
  • sulfotransferase family 4A, member 1
  • sulfotransferase-related protein
  • SULT4A1
  • SULTX3
  • SULTX3DJ388M5.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58314
Species: Hu
Applications: IHC, IHC-P
NBP2-15535
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP1-86617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-44520
Species: Hu, Ca(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IF, MI
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-62583
Species: Hu
Applications: WB
NBP1-81770PEP
Species: Hu
Applications: AC

Publications for Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP) (0)

There are no publications for Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP) (0)

There are no reviews for Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Cytosolic Sulfotransferase 4A1/SULT4A1 Products

Bioinformatics Tool for Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP)

Discover more about diseases related to Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP).
 

Pathways for Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP)

Learn more about PTMs related to Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP).

Blogs on Cytosolic Sulfotransferase 4A1/SULT4A1

There are no specific blogs for Cytosolic Sulfotransferase 4A1/SULT4A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cytosolic Sulfotransferase 4A1/SULT4A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT4A1