Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody

Images

 
Immunohistochemistry: Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody [NBP1-86981] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.

Order Details


    • Catalog Number
      NBP1-86981
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SULT1C4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody

  • Cytosolic Sulfotransferase 1C4
  • EC 2.8.2
  • EC 2.8.2.-
  • EC 2.8.2.1
  • MGC149521
  • MGC34422
  • ST1C4
  • Sulfotransferase 1C2
  • sulfotransferase family, cytosolic, 1C, member 4
  • sulfotransferase family, cytosolic, 1C, member C2
  • SULT1C#2
  • SULT1C2cytosolic, 1C, member 2
  • SULT1C4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-86995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31904
Species: Hu
Applications: WB, IHC, IHC-P
MAB5545
Species: Hu
Applications: WB
AF5828
Species: Hu
Applications: WB, ICC, Neut
MAB5826
Species: Hu
Applications: WB, IHC
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-88813
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59786
Species: Hu
Applications: WB
AF6174
Species: Hu
Applications: WB, IHC, IP
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-86142
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86981
Species: Hu
Applications: IHC, IHC-P

Publications for Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody (NBP1-86981) (0)

There are no publications for Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody (NBP1-86981).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody (NBP1-86981) (0)

There are no reviews for Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody (NBP1-86981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody (NBP1-86981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytosolic Sulfotransferase 1C4/SULT1C4 Products

Bioinformatics Tool for Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody (NBP1-86981)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody (NBP1-86981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody (NBP1-86981)

Discover more about diseases related to Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody (NBP1-86981).
 

Pathways for Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody (NBP1-86981)

View related products by pathway.

Blogs on Cytosolic Sulfotransferase 1C4/SULT1C4

There are no specific blogs for Cytosolic Sulfotransferase 1C4/SULT1C4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytosolic Sulfotransferase 1C4/SULT1C4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT1C4
Entrez