Cytokeratin 7 Antibody

Images

 
Western Blot: Cytokeratin 7 Antibody [H00003855-D01P] - Analysis of KRT7 expression in HeLa.
Western Blot: Cytokeratin 7 Antibody [H00003855-D01P] - Analysis of KRT7 expression in transfected 293T cell line by KRT7 polyclonal antibody.Lane 1: KRT7 transfected lysate(51.40 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related Cytokeratin 7 Primary Antibodies

Order Details


    • Catalog Number
      H00003855-D01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cytokeratin 7 Antibody Summary

Immunogen
KRT7 (AAH02700.1, 1 a.a. - 469 a.a.) full-length human protein. MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRAKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT7
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytokeratin 7 Antibody

  • CK7
  • CK-7
  • cytokeratin 7
  • cytokeratin-7
  • K2C7
  • K7keratin, 55K type II cytoskeletal
  • keratin 7
  • keratin, type II cytoskeletal 7
  • keratin-7
  • MGC129731
  • MGC3625
  • sarcolectin
  • SCLkeratin, simple epithelial type I, K7
  • type II mesothelial keratin K7
  • Type-II keratin Kb7

Background

Cytokeratin 7 is a 54kD intermediate filament protein found in a variety of glandularepithelia. Cytokeratin 7 has been found in columnar and glandular epithelium of the lung, cervix, breast, bile ducts and larger collecting ducts of the kidney. It is present in the transitional epithelium of bladder as well as ovarian and lungepithelia, and occasionally staining of blood vessel cell walls, particularly endothelial cells, may be observed. However, Cytokeratin 7 is not expressed by epithelial cells of the gastrointestinal tract, colon or prostate. Keratin 7 is often co expressed with keratin 19.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-56916
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00003855-D01P
Species: Hu
Applications: WB

Publications for Cytokeratin 7 Antibody (H00003855-D01P) (0)

There are no publications for Cytokeratin 7 Antibody (H00003855-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 7 Antibody (H00003855-D01P) (0)

There are no reviews for Cytokeratin 7 Antibody (H00003855-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytokeratin 7 Antibody (H00003855-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytokeratin 7 Products

Bioinformatics Tool for Cytokeratin 7 Antibody (H00003855-D01P)

Discover related pathways, diseases and genes to Cytokeratin 7 Antibody (H00003855-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 7 Antibody (H00003855-D01P)

Discover more about diseases related to Cytokeratin 7 Antibody (H00003855-D01P).
 

Pathways for Cytokeratin 7 Antibody (H00003855-D01P)

View related products by pathway.

PTMs for Cytokeratin 7 Antibody (H00003855-D01P)

Learn more about PTMs related to Cytokeratin 7 Antibody (H00003855-D01P).
 

Research Areas for Cytokeratin 7 Antibody (H00003855-D01P)

Find related products by research area.

Blogs on Cytokeratin 7

There are no specific blogs for Cytokeratin 7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytokeratin 7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT7
Uniprot