Cytokeratin 4 Antibody (5H5) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Cytokeratin 4 Primary Antibodies

Order Details


    • Catalog Number
      H00003851-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cytokeratin 4 Antibody (5H5) [DyLight 488] Summary

Immunogen
KRT4 (NP_002263 194 a.a. - 300 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTH
Specificity
KRT4 - keratin 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KRT4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytokeratin 4 Antibody (5H5) [DyLight 488]

  • CK4
  • CK-4
  • CYK4cytokeratin-4
  • Cytokeratin-4
  • FLJ31692
  • K4cytokeratin 4
  • keratin 4
  • keratin, type II cytoskeletal 4
  • Keratin-4
  • Type-II keratin Kb4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-38166
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-81572
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34844
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-32962
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-55459
Species: Hu
Applications: ICC/IF
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00003851-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Cytokeratin 4 Antibody (H00003851-M01G) (0)

There are no publications for Cytokeratin 4 Antibody (H00003851-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 4 Antibody (H00003851-M01G) (0)

There are no reviews for Cytokeratin 4 Antibody (H00003851-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cytokeratin 4 Antibody (H00003851-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytokeratin 4 Products

Bioinformatics Tool for Cytokeratin 4 Antibody (H00003851-M01G)

Discover related pathways, diseases and genes to Cytokeratin 4 Antibody (H00003851-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 4 Antibody (H00003851-M01G)

Discover more about diseases related to Cytokeratin 4 Antibody (H00003851-M01G).
 

Pathways for Cytokeratin 4 Antibody (H00003851-M01G)

View related products by pathway.

PTMs for Cytokeratin 4 Antibody (H00003851-M01G)

Learn more about PTMs related to Cytokeratin 4 Antibody (H00003851-M01G).
 

Research Areas for Cytokeratin 4 Antibody (H00003851-M01G)

Find related products by research area.

Blogs on Cytokeratin 4

There are no specific blogs for Cytokeratin 4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytokeratin 4 Antibody (5H5) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT4