Cytokeratin 10 Antibody


Western Blot: Cytokeratin 10 Antibody [NBP1-53114] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related Cytokeratin 10 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cytokeratin 10 Antibody Summary

Synthetic peptides corresponding to KRT10(keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris)) The peptide sequence was selected from the N terminal of KRT10. Peptide sequence EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKH
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against KRT10 and was validated on Western blot.
Positive Control
Cytokeratin 10 Lysate (NBP2-64953)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cytokeratin 10 Antibody

  • BCIE
  • BIE
  • CK10
  • CK-10
  • cytokeratin 10
  • Cytokeratin-10
  • EHK
  • K10keratosis palmaris et plantaris
  • Keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris)
  • keratin 10
  • keratin, type I cytoskeletal 10
  • keratin-10
  • KPP


KRT10 is a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in the gene encoding KRT10 are associated with epidermolytic hyperkeratosis. This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in this gene are associated with epidermolytic hyperkeratosis. This gene is located within a cluster of keratin family members on chromosome 17q21. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC, Single Cell Western
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Fi, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu
Applications: WB, ICC/IF

Publications for Cytokeratin 10 Antibody (NBP1-53114) (0)

There are no publications for Cytokeratin 10 Antibody (NBP1-53114).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 10 Antibody (NBP1-53114) (0)

There are no reviews for Cytokeratin 10 Antibody (NBP1-53114). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytokeratin 10 Antibody (NBP1-53114) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Cytokeratin 10 Products

Bioinformatics Tool for Cytokeratin 10 Antibody (NBP1-53114)

Discover related pathways, diseases and genes to Cytokeratin 10 Antibody (NBP1-53114). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 10 Antibody (NBP1-53114)

Discover more about diseases related to Cytokeratin 10 Antibody (NBP1-53114).

Pathways for Cytokeratin 10 Antibody (NBP1-53114)

View related products by pathway.

PTMs for Cytokeratin 10 Antibody (NBP1-53114)

Learn more about PTMs related to Cytokeratin 10 Antibody (NBP1-53114).

Research Areas for Cytokeratin 10 Antibody (NBP1-53114)

Find related products by research area.

Blogs on Cytokeratin 10

There are no specific blogs for Cytokeratin 10, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cytokeratin 10 Antibody and receive a gift card or discount.


Gene Symbol KRT10