Cytokeratin 1 Antibody (2A7)

Images

 
Sandwich ELISA: Cytokeratin 1 Antibody (2A7) [H00003848-M01] - Detection limit for recombinant GST tagged KRT1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cytokeratin 1 Antibody (2A7) Summary

Immunogen
KRT1 (NP_006112 387 a.a. - 496 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HGDSVRNSKIEISELNRVIQRLRSEIDNVKKQISNLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEESRMSGE
Specificity
KRT1 - keratin 1 (epidermolytic hyperkeratosis)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KRT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytokeratin 1 Antibody (2A7)

  • CK1
  • CK-1
  • cytokeratin 1
  • Cytokeratin-1
  • cytokeratin-1,67 kDa cytokeratin
  • EHK
  • EHK1
  • epidermolytic hyperkeratosis 1
  • EPPK
  • Hair alpha protein
  • K1
  • keratin 1
  • keratin, type II cytoskeletal 1
  • Keratin-1
  • KRT1A
  • KRTA
  • NEPPK
  • Type-II keratin Kb1

Background

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the spinous and granular layers of the epidermis with family member KRT10 and mutations in these genes have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32962
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34844
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P
H00003851-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-38166
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45538
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55459
Species: Hu
Applications: ICC/IF
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cytokeratin 1 Antibody (H00003848-M01) (0)

There are no publications for Cytokeratin 1 Antibody (H00003848-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 1 Antibody (H00003848-M01) (0)

There are no reviews for Cytokeratin 1 Antibody (H00003848-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytokeratin 1 Antibody (H00003848-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytokeratin 1 Products

Bioinformatics Tool for Cytokeratin 1 Antibody (H00003848-M01)

Discover related pathways, diseases and genes to Cytokeratin 1 Antibody (H00003848-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 1 Antibody (H00003848-M01)

Discover more about diseases related to Cytokeratin 1 Antibody (H00003848-M01).
 

Pathways for Cytokeratin 1 Antibody (H00003848-M01)

View related products by pathway.

PTMs for Cytokeratin 1 Antibody (H00003848-M01)

Learn more about PTMs related to Cytokeratin 1 Antibody (H00003848-M01).
 

Research Areas for Cytokeratin 1 Antibody (H00003848-M01)

Find related products by research area.

Blogs on Cytokeratin 1

There are no specific blogs for Cytokeratin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytokeratin 1 Antibody (2A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT1
Entrez
OMIM
Uniprot