Cytochrome P450 3A4/3A5 Antibody

Images

 

Product Details

Summary
Product Discontinued
View other related Cytochrome P450 3A4/3A5 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69666
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cytochrome P450 3A4/3A5 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYP3A4(cytochrome P450, family 3, subfamily A, polypeptide 4) The peptide sequence was selected from the middle region of CYP3A4. Peptide sequence KSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI.
Clonality
Polyclonal
Host
Rabbit
Gene
CYP3A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CYP3A4 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cytochrome P450 3A4/3A5 Antibody

  • Albendazole monooxygenase
  • Albendazole sulfoxidase
  • CP33
  • CP34
  • CYP3A
  • CYP3A3
  • CYPIIIA3
  • CYPIIIA4
  • Cytochrome P450 3A3
  • cytochrome P450 3A4
  • Cytochrome P450 HLp
  • Cytochrome P450 NF-25
  • cytochrome P450, family 3, subfamily A, polypeptide 4
  • cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 3
  • cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4
  • Cytochrome P450-PCN1
  • EC 1.14.13.32
  • EC 1.14.13.67
  • EC 1.14.13.97
  • EC 1.14.14.1
  • glucocorticoid-inducible P450
  • HLP
  • MGC126680
  • NF-25
  • Nifedipine oxidase
  • P450C3
  • P450-III, steroid inducible
  • P450PCN1
  • Quinine 3-monooxygenase
  • Taurochenodeoxycholate 6-alpha-hydroxylase

Background

This gene, CYP3A4, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs which are are used today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-16078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1032
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
H00001551-B01P
Species: Hu
Applications: WB
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP1-69666
Species: Hu
Applications: WB

Publications for Cytochrome P450 3A4/3A5 Antibody (NBP1-69666) (0)

There are no publications for Cytochrome P450 3A4/3A5 Antibody (NBP1-69666).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome P450 3A4/3A5 Antibody (NBP1-69666) (0)

There are no reviews for Cytochrome P450 3A4/3A5 Antibody (NBP1-69666). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 3A4/3A5 Antibody (NBP1-69666) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome P450 3A4/3A5 Products

Cytochrome P450 3A4/3A5 NBP1-69666

Bioinformatics Tool for Cytochrome P450 3A4/3A5 Antibody (NBP1-69666)

Discover related pathways, diseases and genes to Cytochrome P450 3A4/3A5 Antibody (NBP1-69666). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 3A4/3A5 Antibody (NBP1-69666)

Discover more about diseases related to Cytochrome P450 3A4/3A5 Antibody (NBP1-69666).
 

Pathways for Cytochrome P450 3A4/3A5 Antibody (NBP1-69666)

View related products by pathway.

PTMs for Cytochrome P450 3A4/3A5 Antibody (NBP1-69666)

Learn more about PTMs related to Cytochrome P450 3A4/3A5 Antibody (NBP1-69666).
 

Research Areas for Cytochrome P450 3A4/3A5 Antibody (NBP1-69666)

Find related products by research area.

Blogs on Cytochrome P450 3A4/3A5

There are no specific blogs for Cytochrome P450 3A4/3A5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome P450 3A4/3A5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP3A4
Uniprot