Cytochrome P450 2E1 Antibody

Images

 
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-69673] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-69673] - This Anti-CYP2E1 antibody was used in Western Blot of fetal liver tissue lysate at a concentration of 1ug/ml.
Western Blot: Cytochrome P450 2E1 Antibody [NBP1-69673] - Fetal Liver Cell lysates, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Product Discontinued
View other related Cytochrome P450 2E1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69673
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cytochrome P450 2E1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYP2E1(cytochrome P450, family 2, subfamily E, polypeptide 1) The peptide sequence was selected from the C terminal of CYP2E1. Peptide sequence QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL.
Clonality
Polyclonal
Host
Rabbit
Gene
CYP2E1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CYP2E1 and was validated on Western blot.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cytochrome P450 2E1 Antibody

  • 4-nitrophenol 2-hydroxylase
  • CPE1
  • CYP2Ecytochrome P450 2E1
  • CYPIIE1
  • cytochrome P450, family 2, subfamily E, polypeptide 1
  • cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1
  • Cytochrome P450-J
  • EC 1.14.13.-
  • EC 1.14.13.n7
  • EC 1.14.14.1
  • flavoprotein-linked monooxygenase
  • microsomal monooxygenase
  • P450C2E
  • P450-J
  • xenobiotic monooxygenase

Background

CYP2E1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-29875
Species: Mu, Rt
Applications: WB
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-16078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for Cytochrome P450 2E1 Antibody (NBP1-69673) (0)

There are no publications for Cytochrome P450 2E1 Antibody (NBP1-69673).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome P450 2E1 Antibody (NBP1-69673) (0)

There are no reviews for Cytochrome P450 2E1 Antibody (NBP1-69673). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 2E1 Antibody (NBP1-69673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome P450 2E1 Products

Bioinformatics Tool for Cytochrome P450 2E1 Antibody (NBP1-69673)

Discover related pathways, diseases and genes to Cytochrome P450 2E1 Antibody (NBP1-69673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 2E1 Antibody (NBP1-69673)

Discover more about diseases related to Cytochrome P450 2E1 Antibody (NBP1-69673).
 

Pathways for Cytochrome P450 2E1 Antibody (NBP1-69673)

View related products by pathway.

PTMs for Cytochrome P450 2E1 Antibody (NBP1-69673)

Learn more about PTMs related to Cytochrome P450 2E1 Antibody (NBP1-69673).
 

Research Areas for Cytochrome P450 2E1 Antibody (NBP1-69673)

Find related products by research area.

Blogs on Cytochrome P450 2E1

There are no specific blogs for Cytochrome P450 2E1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome P450 2E1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP2E1
Uniprot