Cytochrome c Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Cytochrome c Recombinant Protein Summary

Description
Cytochrome c (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Preparation
Method
in vitro wheat germ expression system
Gene
CYCS

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytochrome c Recombinant Protein

  • CYCHCS
  • CYCS
  • Cytochrome c
  • cytochrome c, somatic
  • THC4

Background

CYCS( AAH08475, 1 a.a. - 106 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-28566
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF800
Species: Hu, Mu
Applications: WB, Simple Western, IP
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56599
Species: Hu
Applications: WB, Flow
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB1489
Species: Hu
Applications: WB
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85479
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
MAB2055
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, ICFlow
H00054205-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for Cytochrome c Recombinant Protein (H00054205-P02) (0)

There are no publications for Cytochrome c Recombinant Protein (H00054205-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome c Recombinant Protein (H00054205-P02) (0)

There are no reviews for Cytochrome c Recombinant Protein (H00054205-P02). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome c Recombinant Protein (H00054205-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytochrome c Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for Cytochrome c Recombinant Protein (H00054205-P02)

Discover related pathways, diseases and genes to Cytochrome c Recombinant Protein (H00054205-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome c Recombinant Protein (H00054205-P02)

Discover more about diseases related to Cytochrome c Recombinant Protein (H00054205-P02).
 

Pathways for Cytochrome c Recombinant Protein (H00054205-P02)

View related products by pathway.

PTMs for Cytochrome c Recombinant Protein (H00054205-P02)

Learn more about PTMs related to Cytochrome c Recombinant Protein (H00054205-P02).
 

Research Areas for Cytochrome c Recombinant Protein (H00054205-P02)

Find related products by research area.

Blogs on Cytochrome c.

Bcl-2 - an antiapoptotic protein with an important role in cancer cell survival
B-cell lymphoma 2 (Bcl-2) protein is an oncogene that normally acts as an apoptotic inhibitor and localizes to the mitochondrial membrane where it prevents the release of cytochrome c. The Bcl-2 protein family consists of over 20 proteins each co...  Read full blog post.

Cytochrome C - a mediator of apoptosis
Cytochrome C is a small heme protein within the inner mitochondrial membrane responsible for carrying electrons within the respiratory transport chain.  Additionally, cytochrome c has also been identified as a player in programmed cell death (apop...  Read full blog post.

Cytochrome C in Apoptosis, Immune Response and Cancer
Cytochrome C is an electron carrier protein that localizes in mitochondrion intermembrane space and has been identified as one of the key signaling molecules of apoptosis or programmed cell death. Suppression of the anti-apoptotic members or activatio...  Read full blog post.

Mitofilin and the Mitochondrial Inner Membrane Organizing System (MINOS)
Mitofilin was originally described as a heart muscle protein due to its high expression in the heart. Recently, analysis of the human heart mitochondrial proteome demonstrated that Mitofilin is one of the most abundant mitochondrial proteins (1). Rese...  Read full blog post.

Bax Research Gives New Insight into Oxidative Apoptosis
Bax is a member of the Bcl-2 family; an extensive range of proteins which play key roles in apoptosis, or programmed cell death, by regulating outer mitochondrial membrane permeability. We at Novus Biologicals are one of the leading antibody suppliers...  Read full blog post.

The Role of the Caspase 3 Antibody in Apoptosis Research
The caspases are a group of cysteine protease enzymes essential to apoptosis, inflammation and necrosis. Caspase 3 has been identified as one of the key mediators of apoptosis.Human caspases form three distinct groups: cytokine activators, which are...  Read full blog post.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CYCS
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00054205-P02 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought