Cystatin B/Stefin B Antibody

Images

 
Western Blot: Cystatin B/Stefin B Antibody [NBP1-54613] - Transfected 293T tissue lysate at a concentration of 0.25ug/ml.
Immunohistochemistry-Paraffin: Cystatin B/Stefin B Antibody [NBP1-54613] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X ...read more

Product Details

Summary
Product Discontinued
View other related Cystatin B/Stefin B Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54613
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cystatin B/Stefin B Antibody Summary

Immunogen
Synthetic peptides corresponding to CSTB(cystatin B (stefin B)) The peptide sequence was selected from the middle region of CSTB. Peptide sequence AGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF.
Clonality
Polyclonal
Host
Rabbit
Gene
CSTB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against CSTB and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cystatin B/Stefin B Antibody

  • CPI-B
  • CST6cystatin B (liver thiol proteinase inhibitor)10STFBcystatin-B
  • CSTB
  • cystatin B (stefin B)
  • Cystatin B
  • EPM1
  • Liver thiol proteinase inhibitor
  • PME
  • Stefin B
  • stefin-B

Background

CSTB is a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in CSTB gene are responsible for the primary defects in patients with progressive myoclonic epilepsy a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy.The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
1407-PI
Species: Hu
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
1407-PI
Species: Hu
AF1013
Species: Mu
Applications: WB, IHC, IP
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42173
Species: Hu
Applications: WB, ICC/IF, ICC
AF2199
Species: Hu
Applications: WB, IP
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-54613
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Cystatin B/Stefin B Antibody (NBP1-54613) (0)

There are no publications for Cystatin B/Stefin B Antibody (NBP1-54613).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cystatin B/Stefin B Antibody (NBP1-54613) (0)

There are no reviews for Cystatin B/Stefin B Antibody (NBP1-54613). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cystatin B/Stefin B Antibody (NBP1-54613) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cystatin B/Stefin B Products

Bioinformatics Tool for Cystatin B/Stefin B Antibody (NBP1-54613)

Discover related pathways, diseases and genes to Cystatin B/Stefin B Antibody (NBP1-54613). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cystatin B/Stefin B Antibody (NBP1-54613)

Discover more about diseases related to Cystatin B/Stefin B Antibody (NBP1-54613).
 

Pathways for Cystatin B/Stefin B Antibody (NBP1-54613)

View related products by pathway.

PTMs for Cystatin B/Stefin B Antibody (NBP1-54613)

Learn more about PTMs related to Cystatin B/Stefin B Antibody (NBP1-54613).
 

Research Areas for Cystatin B/Stefin B Antibody (NBP1-54613)

Find related products by research area.

Blogs on Cystatin B/Stefin B

There are no specific blogs for Cystatin B/Stefin B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cystatin B/Stefin B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSTB
Entrez
Uniprot