Cystatin B/Stefin B Antibody (M2-F1) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Cystatin B/Stefin B Primary Antibodies

Order Details


    • Catalog Number
      H00001476-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cystatin B/Stefin B Antibody (M2-F1) [DyLight 488] Summary

Immunogen
CSTB (AAH03370.1, 1 a.a. - 98 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Specificity
CSTB - cystatin B (stefin B)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSTB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cystatin B/Stefin B Antibody (M2-F1) [DyLight 488]

  • CPI-B
  • CST6cystatin B (liver thiol proteinase inhibitor)10STFBcystatin-B
  • CSTB
  • cystatin B (stefin B)
  • Cystatin B
  • EPM1
  • Liver thiol proteinase inhibitor
  • PME
  • Stefin B
  • stefin-B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
1407-PI
Species: Hu
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
1407-PI
Species: Hu
AF1013
Species: Mu
Applications: WB, IHC, IP
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42173
Species: Hu
Applications: WB, ICC/IF, ICC
AF2199
Species: Hu
Applications: WB, IP
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00001476-M02G
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Cystatin B/Stefin B Antibody (H00001476-M02G) (0)

There are no publications for Cystatin B/Stefin B Antibody (H00001476-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cystatin B/Stefin B Antibody (H00001476-M02G) (0)

There are no reviews for Cystatin B/Stefin B Antibody (H00001476-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cystatin B/Stefin B Antibody (H00001476-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cystatin B/Stefin B Products

Bioinformatics Tool for Cystatin B/Stefin B Antibody (H00001476-M02G)

Discover related pathways, diseases and genes to Cystatin B/Stefin B Antibody (H00001476-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cystatin B/Stefin B Antibody (H00001476-M02G)

Discover more about diseases related to Cystatin B/Stefin B Antibody (H00001476-M02G).
 

Pathways for Cystatin B/Stefin B Antibody (H00001476-M02G)

View related products by pathway.

PTMs for Cystatin B/Stefin B Antibody (H00001476-M02G)

Learn more about PTMs related to Cystatin B/Stefin B Antibody (H00001476-M02G).
 

Research Areas for Cystatin B/Stefin B Antibody (H00001476-M02G)

Find related products by research area.

Blogs on Cystatin B/Stefin B

There are no specific blogs for Cystatin B/Stefin B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cystatin B/Stefin B Antibody (M2-F1) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol CSTB
Entrez