Recombinant Human CYRPTIC/CFC1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related CYRPTIC/CFC1 Peptides and Proteins

Order Details


    • Catalog Number
      H00055997-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CYRPTIC/CFC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 27-93 of Human CFC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRAFGEGASARPRCCRN

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
CFC1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CYRPTIC/CFC1 Protein

  • CFC1
  • CFC-1
  • CFC1B
  • cripto, FRL-1, cryptic family 1
  • Cryptic family protein 1
  • cryptic protein
  • Cryptic
  • CRYPTICFLJ77897
  • HTX2MGC133213

Background

This gene encodes a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. EGF-CFC family member proteins share a variant EGF-like motif, a conserved cysteine-rich domain, and a C-terminal hydrophobic region. These proteins play key roles in intercellular signaling pathways during vertebrate embryogenesis. Mutations in this gene can cause autosomal visceral heterotaxy. This protein is involved in left-right asymmetric morphogenesis during organ development. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
MAB6937
Species: Hu
Applications: WB
MAB994
Species: Mu
Applications: WB
AF5310
Species: Hu, Mu
Applications: WB, ICC
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF339
Species: Hu
Applications: WB, IHC, Block
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
H00027130-P02
Species: Hu
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
AF1075
Species: Hu
Applications: WB
AF4248
Species: Hu
Applications: WB, ICC

Publications for CYRPTIC/CFC1 Partial Recombinant Protein (H00055997-Q01) (0)

There are no publications for CYRPTIC/CFC1 Partial Recombinant Protein (H00055997-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYRPTIC/CFC1 Partial Recombinant Protein (H00055997-Q01) (0)

There are no reviews for CYRPTIC/CFC1 Partial Recombinant Protein (H00055997-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYRPTIC/CFC1 Partial Recombinant Protein (H00055997-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYRPTIC/CFC1 Products

Bioinformatics Tool for CYRPTIC/CFC1 Partial Recombinant Protein (H00055997-Q01)

Discover related pathways, diseases and genes to CYRPTIC/CFC1 Partial Recombinant Protein (H00055997-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYRPTIC/CFC1 Partial Recombinant Protein (H00055997-Q01)

Discover more about diseases related to CYRPTIC/CFC1 Partial Recombinant Protein (H00055997-Q01).
 

Pathways for CYRPTIC/CFC1 Partial Recombinant Protein (H00055997-Q01)

View related products by pathway.

PTMs for CYRPTIC/CFC1 Partial Recombinant Protein (H00055997-Q01)

Learn more about PTMs related to CYRPTIC/CFC1 Partial Recombinant Protein (H00055997-Q01).

Blogs on CYRPTIC/CFC1

There are no specific blogs for CYRPTIC/CFC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CYRPTIC/CFC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CFC1
Entrez