Recombinant Human CYP27A1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CYP27A1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-531 of Human CYP27A1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CYP27A1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CYP27A1 Protein

  • 12-alpha-triol 27-hydroxylase
  • 7-alpha
  • cholestanetriol 26-monooxygenase
  • CP27,5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase
  • CTX5-beta-cholestane-3-alpha
  • CYP275-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase
  • Cytochrome P450 27
  • cytochrome P450, family 27, subfamily A, polypeptide 1
  • cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinousxanthomatosis), polypeptide 1
  • Cytochrome P-450C27/25
  • EC 1.14.13.15
  • sterol 26-hydroxylase, mitochondrial
  • Sterol 27-hydroxylase
  • Vitamin D(3) 25-hydroxylase

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
MAB9120
Species: Hu
Applications: ICC
NBP2-35213
Species: Hu
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-50204
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
H00009420-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CYP27A1 Recombinant Protein (H00001593-P01) (0)

There are no publications for CYP27A1 Recombinant Protein (H00001593-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP27A1 Recombinant Protein (H00001593-P01) (0)

There are no reviews for CYP27A1 Recombinant Protein (H00001593-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP27A1 Recombinant Protein (H00001593-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP27A1 Products

Bioinformatics Tool for CYP27A1 Recombinant Protein (H00001593-P01)

Discover related pathways, diseases and genes to CYP27A1 Recombinant Protein (H00001593-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP27A1 Recombinant Protein (H00001593-P01)

Discover more about diseases related to CYP27A1 Recombinant Protein (H00001593-P01).
 

Pathways for CYP27A1 Recombinant Protein (H00001593-P01)

View related products by pathway.

PTMs for CYP27A1 Recombinant Protein (H00001593-P01)

Learn more about PTMs related to CYP27A1 Recombinant Protein (H00001593-P01).
 

Research Areas for CYP27A1 Recombinant Protein (H00001593-P01)

Find related products by research area.

Blogs on CYP27A1

There are no specific blogs for CYP27A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CYP27A1 Antibody
NBP2-32433
IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CYP27A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP27A1