CYP24A1 Antibody


Western Blot: CYP24A1 Antibody [NBP1-68880] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Product Discontinued
View other related CYP24A1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CYP24A1 Antibody Summary

Synthetic peptides corresponding to CYP24A1 (cytochrome P450, family 24, subfamily A, polypeptide 1) The peptide sequence was selected from the C terminal of CYP24A1. Peptide sequence QVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CYP24A1 and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYP24A1 Antibody

  • 25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
  • CP241
  • CYP241,25-alphadihydroxyvitamin D3 24-hydroxylase
  • Cytochrome P450 24A1
  • cytochrome P450, family 24, subfamily A, polypeptide 1,24-OHase
  • cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase)
  • Cytochrome P450-CC24
  • EC 1.14.13.n4
  • exo-mitochondrial protein
  • MGC126273
  • MGC126274
  • P450-CC24
  • vitamin D 24-hydroxylase
  • Vitamin D(3) 24-hydroxylase


This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Mu
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IHC, IF

Publications for CYP24A1 Antibody (NBP1-68880) (0)

There are no publications for CYP24A1 Antibody (NBP1-68880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP24A1 Antibody (NBP1-68880) (0)

There are no reviews for CYP24A1 Antibody (NBP1-68880). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP24A1 Antibody (NBP1-68880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CYP24A1 Products

Bioinformatics Tool for CYP24A1 Antibody (NBP1-68880)

Discover related pathways, diseases and genes to CYP24A1 Antibody (NBP1-68880). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP24A1 Antibody (NBP1-68880)

Discover more about diseases related to CYP24A1 Antibody (NBP1-68880).

Pathways for CYP24A1 Antibody (NBP1-68880)

View related products by pathway.

PTMs for CYP24A1 Antibody (NBP1-68880)

Learn more about PTMs related to CYP24A1 Antibody (NBP1-68880).

Blogs on CYP24A1

There are no specific blogs for CYP24A1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CYP24A1 Antibody and receive a gift card or discount.


Gene Symbol CYP24A1