CYP24A1 Antibody



Product Details

Product Discontinued
View other related CYP24A1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CYP24A1 Antibody Summary

Synthetic peptides corresponding to CYP24A1 (cytochrome P450, family 24, subfamily A, polypeptide 1) The peptide sequence was selected from the C terminal of CYP24A1. Peptide sequence QVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against CYP24A1 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
55 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: IHC, ICC, ICFlow
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IP, DirELISA
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CYP24A1 Antibody (NBP1-68880) (0)

There are no publications for CYP24A1 Antibody (NBP1-68880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP24A1 Antibody (NBP1-68880) (0)

There are no reviews for CYP24A1 Antibody (NBP1-68880). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for CYP24A1 Antibody (NBP1-68880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP24A1 Antibody Products

Related Products by Gene

Bioinformatics Tool for CYP24A1 Antibody (NBP1-68880)

Discover related pathways, diseases and genes to CYP24A1 Antibody (NBP1-68880). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP24A1 Antibody (NBP1-68880)

Discover more about diseases related to CYP24A1 Antibody (NBP1-68880).

Pathways for CYP24A1 Antibody (NBP1-68880)

View related products by pathway.

PTMs for CYP24A1 Antibody (NBP1-68880)

Learn more about PTMs related to CYP24A1 Antibody (NBP1-68880).

Blogs on CYP24A1

There are no specific blogs for CYP24A1, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol CYP24A1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-68880 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.