Home » CYP11B2 » CYP11B2 Antibodies » CYP11B2 Antibody

CYP11B2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CYP11B2 Antibody [NBP2-92862] - Analysis of extracts of various cell lines, using CYP11B2 .Exposure time: 20s.
Western Blot: CYP11B2 Antibody [NBP2-92862] - Analysis of extracts of various cell lines, using CYP11B2 .Exposure time: 20s.
Immunocytochemistry/ Immunofluorescence: CYP11B2 Antibody [NBP2-92862] - Immunofluorescence analysis of HeLa cells using CYP11B2 antibody (NBP2-92862) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-92862] - Rat adrenal gland using CYP11B2 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-92862] - Mouse adrenal gland using CYP11B2 antibody at dilution of 1:100 (40x lens).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CYP11B2 Antibody Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 234-503 of human CYP11B2 (NP_000489.3). TVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP11B2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1:50 - 1:100
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:1000
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CYP11B2 Antibody

  • ALDOS
  • ALDOSCYP11B
  • Aldosterone synthase
  • Aldosterone-synthesizing enzyme
  • CPN2
  • CYP11B2
  • CYP11BL
  • CYPXIB2
  • cytochrome P450 11B2, mitochondrial
  • cytochrome P450, family 11, subfamily B, polypeptide 2
  • cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2
  • Cytochrome P-450Aldo
  • Cytochrome P-450C18
  • EC 1.14.15
  • EC 1.14.15.4
  • EC 1.14.15.5
  • mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2
  • P450aldo
  • P450C18
  • P-450C18
  • steroid 11-beta/18-hydroxylase
  • steroid 11-beta-monooxygenase
  • Steroid 18-hydroxylase
  • steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo

Background

The CYP11B2 gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins aremonooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids andother lipids. This protein localiz

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CYP11B1 Antibody
NBP1-68883
Western Blot: CYP11B1 Antibody [NBP1-68883] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
Immunohistochemistry: CYP11B1 Antibody [NBP1-68883] - Monkey adrenal gland Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus Gene name: CYP11B1 Submitted by: Jonathan Bertin, Endoceutics Inc.
Immunohistochemistry: CYP11B1 Antibody [NBP1-68883] - Monkey vagina Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus Gene name: CYP11B1 Submitted by: Jonathan Bertin, Endoceutics Inc.
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. Western blot analysis for protein expressions of intrarenal RAS components in the two groups of mice. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Immunohistochemistry: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. (A) Immunohistochemical analysis of intrarenal RAS expression position in the two groups of mice. AGT immunoreactivity in the proximal tubular cells, Ang II immunoreactivity in both glomerular and tubular cells, renin immunoreactivity in juxtaglomerular apparatus cells, ACE immunoreactivity in brush border membranes of proximal tubules as well as AT1 and AT2 immunoreactivity in the proximal tubules were increased in the HF group when compared to the control group. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).
(16 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Renin Antibody
AF4090
Renin was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Renin was detected in immersion fixed paraffin-embedded sections of human kidney array using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Publications)
Species: Hu
Applications: IHC, IP, Neut, WB
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative immunofluorescence images of (B) POMC as a prohormone (n = 5-6 each) in the ARC of mice approximately 5 to 10 weeks of age. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB

SF-1/NR5A1/Steroidogen ...
NBP2-88921
Immunocytochemistry/Immunofluorescence: SF-1/NR5A1/Steroidogenic Factor 1 Antibody (CL9101) [NBP2-88921] - Staining of U-2 OS cells using the Anti-NR5A1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemistry-Paraffin: SF-1/NR5A1/Steroidogenic Factor 1 Antibody (CL9101) [NBP2-88921] - Staining of human adrenal gland shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SF-1/NR5A1/Steroidogenic Factor 1 Antibody (CL9101) [NBP2-88921] - Staining of human breast shows weak to moderate nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Mineralocorticoid
R/NR3C2 Antibody (H10 ...
NB300-562
Immunohistochemistry-Paraffin: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Both normal and cancer biopsies of deparaffinized Human tonsil tissues.
Western Blot: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Analysis of Mineralocorticoid Receptor.
Immunocytochemistry/Immunofluorescence: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Mineralocorticoid Receptor staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Mineralocorticoid Receptor at a dilution of 1:20-1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(2 Publications)
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
Cytochrome P450
17A1 Antibody (OTI3F1
NBP2-01151
Immunohistochemistry: Cytochrome P450 17A1 Antibody (OTI3F11) [NBP2-01151] - Staining in 13 year old testis. Immunoexpression in Leydig cell. Image from a verified customer review.
Immunohistochemistry: Cytochrome P450 17A1 Antibody (OTI3F11) [NBP2-01151] - Staining in macaque Leydig cells. Image from a verified customer review.
Flow Cytometry: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - Analysis of Hela cells, using anti-Cytochrome P450 17A1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
(2 Reviews)
(5 Publications)
Species: Hu
Applications: Flow, IHC, IHC-P, WB
CYP11A1 Antibody
NBP1-85368
Immunohistochemistry-Paraffin: CYP11A1 Antibody [NBP1-85368] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: CYP11A1 Antibody [NBP1-85368] - Staining in human adrenal gland and cerebral cortex tissues using anti-CYP11A1 antibody. Corresponding CYP11A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CYP11A1 Antibody [NBP1-85368] - Staining of human cerebral cortex shows low expression as expected.
(4 Reviews)
(3 Publications)
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
AGTR-1 Antibody -
BSA Free
NBP1-77078
Immunohistochemistry-Paraffin: AGTR-1 Antibody [NBP1-77078] - Staining of mouse kidney tissue with antibody at 2.5 ug/ml.
Immunohistochemistry-Paraffin: AGTR-1 Antibody [NBP1-77078] - Mouse kidney tissue at 2.5 ug/mL.
Western Blot: AGTR-1 Antibody [NBP1-77078] - Effects of Ang(1-7) and/or A-779 treatments to the sham and OVX animals for 6 weeks on the expressions of RAS different proteins and osteoclastogenesis modulating factors in the femoral bone heads. Western blot analysis bands showing the expressions of AngII, Ang(1-7), AT1R, AT2R, ACE, ACE-2, MasR, RANKL and OPG. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-02570-x) licensed under a CC-BY licence.
(9 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Angiogenin [HRP]
DAN00
(23 Publications)
Species: Hu
Applications: ELISA
CYP21A2 Antibody
NBP2-13893
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human testis.
Immunohistochemistry-Paraffin: CYP21A2 Antibody [NBP2-13893] - Staining of human kidney.
Species: Hu
Applications: IHC, IHC-P, WB
Aromatase Antibody
NB100-1596
Western Blot: Aromatase Antibody [NB100-1596] - Detection of aromatase in human fetal temporal lobe lysate using NB 100-1596. ECL exposure, 1-2 minutes.
Western Blot: Aromatase Antibody [NB100-1596] - Expression of the cytochrome P450 aromatase in the ovary of control (C; open bar; n = 6) and hypothyroid (Hypo; solid bar; n = 6) rabbits. Representative immunoblot showing the expression of aromatase. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/bmri/2017/3795950/), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Aromatase Antibody [NB100-1596] - Expression of the cytochrome P450 aromatase in the ovary of hypothyroid (Hypo; solid bar; n = 6) rabbits. Immunoreactivity of antiaromatase (+) was identified in granulosa cells of antral follicles (tertiary, tf; Graafian, gf) of hypothyroid ovaries. Nonlabeling was observed when the primary antibody was omitted. Bars: 100 um (1st image); and 20 um (2nd image). Granulose cells, gc; theca cells, tc. Image collected and cropped by CiteAb from the following publication (https://www.hindawi.com/journals/bmri/2017/3795950/), licensed under a CC-BY licence.
(12 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
AGXT Antibody
NBP1-89200
Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Analysis in human liver and pancreas tissues. Corresponding AGXT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human liver shows strong granular positivity in cytoplasm in hepatocytes.
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
Transcobalamin II
Antibody
AF7895
Western blot shows lysates of HUVEC human umbilical vein endothelial cells and RPMI 8226 human multiple myeloma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Transcobalamin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7895) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Transcobalamin II at approximately 43 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Transcobalamin II was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human/Mouse/Rat Transcobalamin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7895) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm in epithelial cell convoluted tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC, WB
CD55/DAF Antibody
[Unconjugated]
AF2009
CD55/DAF was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using 15 µg/mL Goat Anti-Human CD55/DAF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2009) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CD55/DAF was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line (left panel, positive staining) and MOLT-4 human acute lymphoblastic leukemia cell line (right panel, negative staining) using Goat Anti-Human CD55/DAF Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2009) at 0.5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(5 Publications)
Species: Hu
Applications: ICC, IHC
StAR Antibody
NBP1-33485
Immunohistochemistry-Paraffin: StAR Antibody [NBP1-33485] - Human hepatoma. StAR antibody dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Immunocytochemistry/Immunofluorescence: StAR Antibody [NBP1-33485] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: StAR protein stained by StAR antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: StAR Antibody [NBP1-33485] - Whole cell extract (30 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with StAR antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(3 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
HSD11B2 Antibody
NBP2-37898
Western Blot: HSD11B2 Antibody [NBP2-37898] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue
Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37898] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: HSD11B2 Antibody [NBP2-37898] - Staining of human liver shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P, WB
Nurr1/NGFI-B
beta/NR4A2 Antibody [ ...
AF2156
Nurr1/NGFI‑B beta /NR4A2 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Goat Anti-Human/Mouse Nurr1/NGFI‑B beta /NR4A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2156) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. Staining was performed using our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Nurr1/NGFI‑B beta /NR4A2 was detected in immersion fixed paraffin-embedded sections of mouse brain (hippocampus) using Goat Anti-Human/Mouse Nurr1/NGFI‑B beta /NR4A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2156) at 15 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neurons. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(7 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
CYP11B2 Antibody
NBP2-92862
CYP11B2 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CYP11B2 Antibody (NBP2-92862) (0)

There are no publications for CYP11B2 Antibody (NBP2-92862).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP11B2 Antibody (NBP2-92862) (0)

There are no reviews for CYP11B2 Antibody (NBP2-92862). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CYP11B2 Antibody (NBP2-92862) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP11B2 Products

Bioinformatics Tool for CYP11B2 Antibody (NBP2-92862)

Discover related pathways, diseases and genes to CYP11B2 Antibody (NBP2-92862). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP11B2 Antibody (NBP2-92862)

Discover more about diseases related to CYP11B2 Antibody (NBP2-92862).
 

Pathways for CYP11B2 Antibody (NBP2-92862)

View related products by pathway.

PTMs for CYP11B2 Antibody (NBP2-92862)

Learn more about PTMs related to CYP11B2 Antibody (NBP2-92862).
 

Research Areas for CYP11B2 Antibody (NBP2-92862)

Find related products by research area.

Blogs on CYP11B2

There are no specific blogs for CYP11B2, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP11B2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CYP11B2