Novus Biologicals products are now on bio-techne.com

CYP11B2 Antibody - BSA Free

Images

 
Western Blot: CYP11B2 Antibody [NBP2-92862] - Analysis of extracts of various cell lines, using CYP11B2 .Exposure time: 20s.
Immunocytochemistry/ Immunofluorescence: CYP11B2 Antibody [NBP2-92862] - Immunofluorescence analysis of HeLa cells using CYP11B2 antibody (NBP2-92862) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-92862] - Rat adrenal gland using CYP11B2 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-92862] - Mouse adrenal gland using CYP11B2 antibody at dilution of 1:100 (40x lens).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

CYP11B2 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 234-503 of human CYP11B2 (NP_000489.3). TVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP11B2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:1000
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CYP11B2 Antibody - BSA Free

  • ALDOS
  • ALDOSCYP11B
  • Aldosterone synthase
  • Aldosterone-synthesizing enzyme
  • CPN2
  • CYP11B2
  • CYP11BL
  • CYPXIB2
  • cytochrome P450 11B2, mitochondrial
  • cytochrome P450, family 11, subfamily B, polypeptide 2
  • cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2
  • Cytochrome P-450Aldo
  • Cytochrome P-450C18
  • EC 1.14.15
  • EC 1.14.15.4
  • EC 1.14.15.5
  • mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2
  • P450aldo
  • P450C18
  • P-450C18
  • steroid 11-beta/18-hydroxylase
  • steroid 11-beta-monooxygenase
  • Steroid 18-hydroxylase
  • steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo

Background

The CYP11B2 gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins aremonooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids andother lipids. This protein localiz

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-68883
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NB100-62346
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
MAB4447
Species: Hu
Applications: IHC, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-52823
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB300-562
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77078
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DAN00
Species: Hu
Applications: ELISA
NBP2-13893
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-89200
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
AF7895
Species: Hu
Applications: IHC, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP3-25696
Species: Ca, Fe, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37898
Species: Hu
Applications: IHC, IHC-P, WB
AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-92862
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for CYP11B2 Antibody (NBP2-92862) (0)

There are no publications for CYP11B2 Antibody (NBP2-92862).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP11B2 Antibody (NBP2-92862) (0)

There are no reviews for CYP11B2 Antibody (NBP2-92862). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CYP11B2 Antibody (NBP2-92862) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP11B2 Products

Research Areas for CYP11B2 Antibody (NBP2-92862)

Find related products by research area.

Blogs on CYP11B2

There are no specific blogs for CYP11B2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP11B2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP11B2