Recombinant Human CYorf15A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CYorf15A Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 82 - 180 of Human CYorf15B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YKVFQIKLERLEKLYKALQIERNELSEKLGILKGQVSVKVADVDLAVPVTHSCADLDSSNMLNTSSKRAPGVHLEADPKGMNEVKCYSKALSTGSPLGI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CYORF15A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CYorf15A Protein

  • CYorf15A
  • CYorf15B
  • taxilin gamma 2, pseudogene
  • TXLNG2P taxilin gamma 2, pseudogene

Background

CYorf15B - chromosome Y open reading frame 15B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for CYorf15A Partial Recombinant Protein (H00084663-Q01) (0)

There are no publications for CYorf15A Partial Recombinant Protein (H00084663-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYorf15A Partial Recombinant Protein (H00084663-Q01) (0)

There are no reviews for CYorf15A Partial Recombinant Protein (H00084663-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYorf15A Partial Recombinant Protein (H00084663-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYorf15A Products

Bioinformatics Tool for CYorf15A Partial Recombinant Protein (H00084663-Q01)

Discover related pathways, diseases and genes to CYorf15A Partial Recombinant Protein (H00084663-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CYorf15A

There are no specific blogs for CYorf15A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CYorf15A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYORF15A