Recombinant Human CYLC2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CYLC2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human CYLC2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSLPRFQRVNFGPYDNYIPVSELSKKSWNQQHFALLFPKPQRPGTKRRSKPSQIRDNTVSIIDEEQLRGDRRQPLWMYRSLMRISERPSVYLAARRQPLK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CYLC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CYLC2 GST (N-Term) Protein

  • CYL2
  • Cylicin II
  • cylicin, basic protein of sperm head cytoskeleton 2
  • cylicin-2
  • MGC129591
  • Multiple-band polypeptide II

Background

Cylicin II (CYCL2) is specifically expressed in testis and is part of the cytoskeletal calyx of mammalian sperm heads. Cylicin II may play a role in the morphogenesis of the sperm head. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56428
Species: Hu
Applications: IHC, IHC-P
H00000881-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-13225
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86022
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-85407
Species: Hu, Pm, RM
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83086
Species: Hu, Po
Applications: ICC, IHC, IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93039
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-91751
Species: Hu
Applications: IHC, IHC-P
NBP2-20774
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DY674
Species: Hu
Applications: ELISA
NBP1-05767
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-90038
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-14260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-85409
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for CYLC2 Partial Recombinant Protein (H00001539-Q01) (0)

There are no publications for CYLC2 Partial Recombinant Protein (H00001539-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYLC2 Partial Recombinant Protein (H00001539-Q01) (0)

There are no reviews for CYLC2 Partial Recombinant Protein (H00001539-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYLC2 Partial Recombinant Protein (H00001539-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYLC2 Products

Bioinformatics Tool for CYLC2 Partial Recombinant Protein (H00001539-Q01)

Discover related pathways, diseases and genes to CYLC2 Partial Recombinant Protein (H00001539-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYLC2 Partial Recombinant Protein (H00001539-Q01)

Discover more about diseases related to CYLC2 Partial Recombinant Protein (H00001539-Q01).
 

Pathways for CYLC2 Partial Recombinant Protein (H00001539-Q01)

View related products by pathway.

Blogs on CYLC2

There are no specific blogs for CYLC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CYLC2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYLC2