Cyclophilin B Antibody

Images

 
Western Blot: Cyclophilin B Antibody [NBP1-69378] - This Anti-PPIB antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.
Immunohistochemistry: Cyclophilin B Antibody [NBP1-69378] - Staining of human Lung.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cyclophilin B Antibody Summary

Immunogen
Synthetic peptides corresponding to PPIB(peptidylprolyl isomerase B (cyclophilin B)) The peptide sequence was selected from the middle region of PPIB. Peptide sequence FITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPIB
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cyclophilin B Antibody

  • Cyclophilin B
  • cyclophilin-like protein
  • CYPB
  • CYPBEC 5.2.1.8
  • CYP-S1
  • MGC2224
  • OI9MGC14109
  • peptidyl-prolyl cis-trans isomerase B
  • peptidylprolyl isomerase B (cyclophilin B)
  • PPIase B
  • PPIB
  • Rotamase B
  • S-cyclophilin
  • SCYLP

Background

PPIB is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00064175-B01P
Species: Hu
Applications: WB
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-94105
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB3777
Species: Hu, Mu, Rt
Applications: WB
AF972
Species: Hu
Applications: WB, Simple Western, IHC
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58529
Species: Hu
Applications: ICC/IF
NBP1-85360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-408
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83889
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13794
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cyclophilin B Antibody (NBP1-69378) (0)

There are no publications for Cyclophilin B Antibody (NBP1-69378).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclophilin B Antibody (NBP1-69378) (0)

There are no reviews for Cyclophilin B Antibody (NBP1-69378). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cyclophilin B Antibody (NBP1-69378) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclophilin B Products

Bioinformatics Tool for Cyclophilin B Antibody (NBP1-69378)

Discover related pathways, diseases and genes to Cyclophilin B Antibody (NBP1-69378). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclophilin B Antibody (NBP1-69378)

Discover more about diseases related to Cyclophilin B Antibody (NBP1-69378).
 

Pathways for Cyclophilin B Antibody (NBP1-69378)

View related products by pathway.

PTMs for Cyclophilin B Antibody (NBP1-69378)

Learn more about PTMs related to Cyclophilin B Antibody (NBP1-69378).

Blogs on Cyclophilin B

There are no specific blogs for Cyclophilin B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclophilin B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIB
Entrez
Uniprot