Cyclin H Antibody (1B8) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related Cyclin H Primary Antibodies

Order Details


    • Catalog Number
      H00000902-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cyclin H Antibody (1B8) [PE] Summary

Immunogen
CCNH (AAH05280, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAF
Specificity
CCNH - cyclin H
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CCNH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cyclin H Antibody (1B8) [PE]

  • CAK
  • cyclin H
  • cyclin-dependent kinase-activating kinase complex subunit
  • cyclin-H
  • MO15-associated protein
  • p34CAK complex subunit
  • p37CDK-activating kinase complex subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-581
Species: Hu
Applications: WB, IHC, IP, PLA
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF6349
Species: Hu, Mu, Rt
Applications: WB
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-81257
Species: Hu
Applications: IHC, IHC-P
NBL1-11392
Species: Hu
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5588
Species: Hu, Mu
Applications: WB, IHC
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC

Publications for Cyclin H Antibody (H00000902-M01PE) (0)

There are no publications for Cyclin H Antibody (H00000902-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclin H Antibody (H00000902-M01PE) (0)

There are no reviews for Cyclin H Antibody (H00000902-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cyclin H Antibody (H00000902-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclin H Products

Bioinformatics Tool for Cyclin H Antibody (H00000902-M01PE)

Discover related pathways, diseases and genes to Cyclin H Antibody (H00000902-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclin H Antibody (H00000902-M01PE)

Discover more about diseases related to Cyclin H Antibody (H00000902-M01PE).
 

Pathways for Cyclin H Antibody (H00000902-M01PE)

View related products by pathway.

PTMs for Cyclin H Antibody (H00000902-M01PE)

Learn more about PTMs related to Cyclin H Antibody (H00000902-M01PE).
 

Research Areas for Cyclin H Antibody (H00000902-M01PE)

Find related products by research area.

Blogs on Cyclin H

There are no specific blogs for Cyclin H, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclin H Antibody (1B8) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNH