Cyclin B1 Antibody

Images

 
Western Blot: Cyclin B1 Antibody [H00000891-D01P] - Analysis of CCNB1 expression in transfected 293T cell line by CCNB1 polyclonal antibody.Lane 1: CCNB1 transfected lysate(48.30 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: Cyclin B1 Antibody [H00000891-D01P] - Analysis of protein-protein interactions between CCNB1 and CDKN1A. HeLa cells were stained with anti-CCNB1 rabbit purified polyclonal 1:1200 and ...read more
Proximity Ligation Assay: Cyclin B1 Antibody [H00000891-D01P] - Analysis of protein-protein interactions between CCNB1 and PKMYT1. Huh7 cells were stained with anti-CCNB1 rabbit purified polyclonal 1:1200 and ...read more
Proximity Ligation Assay: Cyclin B1 Antibody [H00000891-D01P] - Analysis of protein-protein interactions between CCNB1 and CDC25A. Mahlavu cells were stained with anti-CCNB1 rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cyclin B1 Antibody Summary

Immunogen
CCNB1 (NP_114172.1, 1 a.a. - 433 a.a.) full-length human protein. MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Marker
Mitosis Marker
Specificity
CCNB1 - cyclin B1,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCNB1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000891-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cyclin B1 Antibody

  • CCNB
  • CCNB1
  • Cyclin B1
  • G2/mitotic-specific cyclin B1
  • G2/mitotic-specific cyclin-B1

Background

The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000891-D01P
Species: Hu
Applications: WB, PLA

Publications for Cyclin B1 Antibody (H00000891-D01P)(1)

Reviews for Cyclin B1 Antibody (H00000891-D01P) (0)

There are no reviews for Cyclin B1 Antibody (H00000891-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cyclin B1 Antibody (H00000891-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclin B1 Products

Bioinformatics Tool for Cyclin B1 Antibody (H00000891-D01P)

Discover related pathways, diseases and genes to Cyclin B1 Antibody (H00000891-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclin B1 Antibody (H00000891-D01P)

Discover more about diseases related to Cyclin B1 Antibody (H00000891-D01P).
 

Pathways for Cyclin B1 Antibody (H00000891-D01P)

View related products by pathway.

PTMs for Cyclin B1 Antibody (H00000891-D01P)

Learn more about PTMs related to Cyclin B1 Antibody (H00000891-D01P).
 

Research Areas for Cyclin B1 Antibody (H00000891-D01P)

Find related products by research area.

Blogs on Cyclin B1

There are no specific blogs for Cyclin B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclin B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNB1
Entrez
Uniprot