CXorf67 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: CXorf67 Antibody [NBP2-47498] - Staining of human kidney, liver, skeletal muscle and testis using Anti-CXorf67 antibody NBP2-47498 (A) shows similar protein ...read more
Independent Antibodies: Western Blot: CXorf67 Antibody [NBP2-47498] - Analysis NBP2-47498 (A) shows similar pattern to independent antibody NBP2-47499 (B).
Orthogonal Strategies: Western Blot: CXorf67 Antibody [NBP2-47498] - Analysis in human cell line U-2 OS and human cell line A-549.
Immunocytochemistry/ Immunofluorescence: CXorf67 Antibody [NBP2-47498] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CXorf67 Antibody [NBP2-47498] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: CXorf67 Antibody [NBP2-47498] - Staining of human placenta shows weak nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: CXorf67 Antibody [NBP2-47498] - Staining of human testis shows weak to moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CXorf67 Antibody [NBP2-47498] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.
Immunohistochemistry-Paraffin: CXorf67 Antibody [NBP2-47498] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXorf67 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TVSSQASPSGGAALSSSTAGSSAAAATSAAIFITDEASGLPIIAAVLTERHSDRQDCRSPHEVFGCVVPEGGSQAAVGPQKATGHADEHLAQTKSPGNSRRRKQPCRNQAAPAQKPPGRRLFPEPLPPSSPGFRPSSYPCSGAST
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LOC340602
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CXorf67 Recombinant Protein Antigen (NBP2-47498PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXorf67 Antibody

  • CXorf67 chromosome X open reading frame 67

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CXorf67 Antibody (NBP2-47498) (0)

There are no publications for CXorf67 Antibody (NBP2-47498).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXorf67 Antibody (NBP2-47498) (0)

There are no reviews for CXorf67 Antibody (NBP2-47498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CXorf67 Antibody (NBP2-47498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXorf67 Products

Bioinformatics Tool for CXorf67 Antibody (NBP2-47498)

Discover related pathways, diseases and genes to CXorf67 Antibody (NBP2-47498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CXorf67

There are no specific blogs for CXorf67, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXorf67 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LOC340602