CXorf64 Antibody

Images

 
Western Blot: CXorf64 Antibody [NBP2-14639] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: CXorf64 Antibody [NBP2-14639] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXorf64 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SCIPLHSLRAHRHPYGPPPAVAEESLATAEVNSSDALAGWRQEGQDAINV SWEVSGGPPALIVGGTKVNNG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CXorf64
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CXorf64 Protein (NBP2-14639PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXorf64 Antibody

  • CXorf64 chromosome X open reading frame 64

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-87115
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46000
Species: Hu
Applications: WB, IHC
NBP1-31702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-14639
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CXorf64 Antibody (NBP2-14639) (0)

There are no publications for CXorf64 Antibody (NBP2-14639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXorf64 Antibody (NBP2-14639) (0)

There are no reviews for CXorf64 Antibody (NBP2-14639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXorf64 Antibody (NBP2-14639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXorf64 Products

CXorf64 NBP2-14639

Bioinformatics Tool for CXorf64 Antibody (NBP2-14639)

Discover related pathways, diseases and genes to CXorf64 Antibody (NBP2-14639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXorf64 Antibody (NBP2-14639)

Discover more about diseases related to CXorf64 Antibody (NBP2-14639).

Blogs on CXorf64

There are no specific blogs for CXorf64, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXorf64 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CXorf64