CXorf64 Antibody


Western Blot: CXorf64 Antibody [NBP2-14639] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: CXorf64 Antibody [NBP2-14639] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CXorf64 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SCIPLHSLRAHRHPYGPPPAVAEESLATAEVNSSDALAGWRQEGQDAINV SWEVSGGPPALIVGGTKVNNG
Specificity of human CXorf64 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CXorf64 Protein (NBP2-14639PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CXorf64 Antibody

  • CXorf64 chromosome X open reading frame 64


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, PLA
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CXorf64 Antibody (NBP2-14639) (0)

There are no publications for CXorf64 Antibody (NBP2-14639).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXorf64 Antibody (NBP2-14639) (0)

There are no reviews for CXorf64 Antibody (NBP2-14639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXorf64 Antibody (NBP2-14639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CXorf64 Products

CXorf64 NBP2-14639

Bioinformatics Tool for CXorf64 Antibody (NBP2-14639)

Discover related pathways, diseases and genes to CXorf64 Antibody (NBP2-14639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXorf64 Antibody (NBP2-14639)

Discover more about diseases related to CXorf64 Antibody (NBP2-14639).

Blogs on CXorf64

There are no specific blogs for CXorf64, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CXorf64 Antibody and receive a gift card or discount.


Gene Symbol CXorf64