CXorf61 Antibody

Images

 
Immunohistochemistry-Paraffin: CXorf61 Antibody [NBP1-84343] - Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in a subset of cells in seminiferous tubules.
Immunohistochemistry-Paraffin: CXorf61 Antibody [NBP1-84343] - Immunohistochemical staining of human endometrium shows no positivity in glandular or stromal cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXorf61 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CXORF61
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CXorf61 Protein (NBP1-84343PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXorf61 Antibody

  • chromosome X open reading frame 61
  • CT83
  • CT83Cancer/testis antigen 83
  • FLJ20611
  • FLJ22913
  • kita-kyushu lung cancer antigen 1
  • KKLC1
  • KK-LC-1
  • KK-LC-1KKLC1
  • RP3-452H17.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-84343
Species: Hu
Applications: IHC, IHC-P

Publications for CXorf61 Antibody (NBP1-84343) (0)

There are no publications for CXorf61 Antibody (NBP1-84343).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXorf61 Antibody (NBP1-84343) (0)

There are no reviews for CXorf61 Antibody (NBP1-84343). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CXorf61 Antibody (NBP1-84343) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXorf61 Products

Bioinformatics Tool for CXorf61 Antibody (NBP1-84343)

Discover related pathways, diseases and genes to CXorf61 Antibody (NBP1-84343). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CXorf61

There are no specific blogs for CXorf61, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXorf61 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CXORF61