CXorf57 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CXorf57 Antibody [NBP2-13887] - Staining of human cell line A-431 shows localization to intermediate filaments.
Immunohistochemistry-Paraffin: CXorf57 Antibody [NBP2-13887] - Staining of human placenta shows distinct membranous positivity in trophoblasts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXorf57 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KQVKPEWRLPKLNHRFTTRSELDDMPENCICDVIGLLVFVGRVQRSKKKE NREDFWSYRWIHIADGTSEQPFIVELFSTSQPEIFENIYPMAYFVCTQLK VVRNDNQVPKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CXORF57
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CXorf57 Protein (NBP2-13887PEP)
Publications
Read Publication using NBP2-13887.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXorf57 Antibody

  • chromosome X open reading frame 57
  • RP11-647M7.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CXorf57 Antibody (NBP2-13887)(1)

Reviews for CXorf57 Antibody (NBP2-13887) (0)

There are no reviews for CXorf57 Antibody (NBP2-13887). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CXorf57 Antibody (NBP2-13887) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXorf57 Products

Bioinformatics Tool for CXorf57 Antibody (NBP2-13887)

Discover related pathways, diseases and genes to CXorf57 Antibody (NBP2-13887). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CXorf57

There are no specific blogs for CXorf57, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXorf57 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CXORF57