CXorf26 Antibody

Images

 
Western Blot: CXorf26 Antibody [NBP1-82657] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: CXorf26 Antibody [NBP1-82657] - Staining of human cell line A-431 shows positivity in nucleus, nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: CXorf26 Antibody [NBP1-82657] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXorf26 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVYYKLISSVDPQFLKLTKVDDQIYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFFAIEIARNREGYNKAVYISVQDKEGEKGVNNGGEKRADSGEEENTKNGGEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PBDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CXorf26 Protein (NBP1-82657PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXorf26 Antibody

  • chromosome X open reading frame 26
  • hypothetical protein LOC51260
  • MGC874,2610029G23Rik

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55541
Species: Hu
Applications: WB, ICC/IF
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB1774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-85291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
NBP1-82657
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CXorf26 Antibody (NBP1-82657) (0)

There are no publications for CXorf26 Antibody (NBP1-82657).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXorf26 Antibody (NBP1-82657) (0)

There are no reviews for CXorf26 Antibody (NBP1-82657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CXorf26 Antibody (NBP1-82657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXorf26 Products

Bioinformatics Tool for CXorf26 Antibody (NBP1-82657)

Discover related pathways, diseases and genes to CXorf26 Antibody (NBP1-82657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXorf26 Antibody (NBP1-82657)

Discover more about diseases related to CXorf26 Antibody (NBP1-82657).
 

Pathways for CXorf26 Antibody (NBP1-82657)

View related products by pathway.

Blogs on CXorf26

There are no specific blogs for CXorf26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXorf26 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PBDC1