CXCR6 Antibody

Images

 
Western Blot: CXCR6 Antibody [NBP2-13884] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: CXCR6 Antibody [NBP2-13884] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXCR6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CXCR6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CXCR6 Protein (NBP2-13884PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXCR6 Antibody

  • Bonzo
  • BONZOG-protein coupled receptor bonzo
  • CD186 antigen
  • CD186
  • CDw186
  • chemokine (C-X-C motif) receptor 6
  • C-X-C chemokine receptor type 6
  • CXCR6
  • CXC-R6
  • CXCR-6
  • G protein-coupled receptor
  • STRL33
  • STRL33G-protein coupled receptor STRL33
  • TYMSTRCD186

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF976
Species: Hu, Pm
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
MAB3654
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
MAB145
Species: Hu
Applications: Flow, CyTOF-ready
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
MAB160
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-48337
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB100-709
Species: Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-76949
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1364
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-30869
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CXCR6 Antibody (NBP2-13884) (0)

There are no publications for CXCR6 Antibody (NBP2-13884).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCR6 Antibody (NBP2-13884) (0)

There are no reviews for CXCR6 Antibody (NBP2-13884). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXCR6 Antibody (NBP2-13884) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXCR6 Products

Bioinformatics Tool for CXCR6 Antibody (NBP2-13884)

Discover related pathways, diseases and genes to CXCR6 Antibody (NBP2-13884). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCR6 Antibody (NBP2-13884)

Discover more about diseases related to CXCR6 Antibody (NBP2-13884).
 

Pathways for CXCR6 Antibody (NBP2-13884)

View related products by pathway.

PTMs for CXCR6 Antibody (NBP2-13884)

Learn more about PTMs related to CXCR6 Antibody (NBP2-13884).
 

Research Areas for CXCR6 Antibody (NBP2-13884)

Find related products by research area.

Blogs on CXCR6

There are no specific blogs for CXCR6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCR6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCR6
Entrez