CXCL8/IL-8 Antibody (4C7)



Product Details

Product Discontinued
View other related CXCL8/IL-8 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CXCL8/IL-8 Antibody (4C7) Summary

IL8 (AAH13615, 21 a.a. - 99 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
IL8 (4C7)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCL8/IL-8 Antibody (4C7)

  • 3-10C
  • AMCF-I
  • C-X-C motif chemokine 8
  • CXCL8
  • Emoctakin
  • GCP1
  • GCP-1TSG-1
  • IL8
  • IL-8
  • interleukin 8
  • K60
  • LAI
  • LECT
  • member 8
  • NAP1
  • NAP-1NAP1
  • NCF
  • Neutrophil-activating protein 1
  • Protein 3-10C
  • T cell chemotactic factor
  • T-cell chemotactic factor
  • TCF
  • TSG1


The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS

Publications for CXCL8/IL-8 Antibody (H00003576-M15) (0)

There are no publications for CXCL8/IL-8 Antibody (H00003576-M15).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCL8/IL-8 Antibody (H00003576-M15) (0)

There are no reviews for CXCL8/IL-8 Antibody (H00003576-M15). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXCL8/IL-8 Antibody (H00003576-M15) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CXCL8/IL-8 Products

Bioinformatics Tool for CXCL8/IL-8 Antibody (H00003576-M15)

Discover related pathways, diseases and genes to CXCL8/IL-8 Antibody (H00003576-M15). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCL8/IL-8 Antibody (H00003576-M15)

Discover more about diseases related to CXCL8/IL-8 Antibody (H00003576-M15).

Pathways for CXCL8/IL-8 Antibody (H00003576-M15)

View related products by pathway.

PTMs for CXCL8/IL-8 Antibody (H00003576-M15)

Learn more about PTMs related to CXCL8/IL-8 Antibody (H00003576-M15).

Research Areas for CXCL8/IL-8 Antibody (H00003576-M15)

Find related products by research area.

Blogs on CXCL8/IL-8

There are no specific blogs for CXCL8/IL-8, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CXCL8/IL-8 Antibody (4C7) and receive a gift card or discount.


Gene Symbol IL8