CXCL5 Antibody (M1)

Images

 
Western Blot: CXCL5 Antibody (M1) [H00006374-M03] - Analysis of CXCL5 expression in transfected 293T cell line by CXCL5 monoclonal antibody (M03), clone M1. Lane 1: CXCL5 transfected lysatE (12 KDa). Lane 2: ...read more
Sandwich ELISA: CXCL5 Antibody (M1) [H00006374-M03] - Detection limit for recombinant GST tagged CXCL5 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
M1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CXCL5 Antibody (M1) Summary

Immunogen
CXCL5 (AAH08376, 1 a.a. - 114 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN
Specificity
CXCL5 - chemokine (C-X-C motif) ligand 5
Isotype
IgG1 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
CXCL5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCL5 Antibody (M1)

  • chemokine (C-X-C motif) ligand 5
  • C-X-C motif chemokine 5
  • ENA-78
  • ENA-78(1-78)
  • epithelial-derived neutrophil activating protein 78
  • epithelial-derived neutrophil-activating peptide 78
  • Epithelial-derived neutrophil-activating protein 78
  • Neutrophil-activating peptide ENA-78
  • neutrophil-activating protein 78
  • SCYB5ENA78
  • small inducible cytokine B5
  • small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derivedneutrophil-activating peptide 78)
  • Small-inducible cytokine B5

Background

The protein encoded by this gene is an inflammatory chemokine that belongs to the CXC chemokine family. This chemokine is produced concomitantly with interleukin-8 (IL8) in response to stimulation with either interleukin-1 (IL1) or tumor necrosis factor-alpha (TNFA). This chemokine is a potent chemotaxin involved in neutrophil activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
MAB333
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB331
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-53097
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
MAB330
Species: Hu
Applications: Flow, IHC, CyTOF-reported, Neut
H00006374-M03
Species: Hu
Applications: WB, ELISA

Publications for CXCL5 Antibody (H00006374-M03) (0)

There are no publications for CXCL5 Antibody (H00006374-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCL5 Antibody (H00006374-M03) (0)

There are no reviews for CXCL5 Antibody (H00006374-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXCL5 Antibody (H00006374-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXCL5 Products

Bioinformatics Tool for CXCL5 Antibody (H00006374-M03)

Discover related pathways, diseases and genes to CXCL5 Antibody (H00006374-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCL5 Antibody (H00006374-M03)

Discover more about diseases related to CXCL5 Antibody (H00006374-M03).
 

Pathways for CXCL5 Antibody (H00006374-M03)

View related products by pathway.

PTMs for CXCL5 Antibody (H00006374-M03)

Learn more about PTMs related to CXCL5 Antibody (H00006374-M03).
 

Research Areas for CXCL5 Antibody (H00006374-M03)

Find related products by research area.

Blogs on CXCL5

There are no specific blogs for CXCL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCL5 Antibody (M1) and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCL5
Entrez
OMIM
Uniprot