Recombinant Mouse CXCL12/SDF-1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related CXCL12/SDF-1 Peptides and Proteins

Order Details


    • Catalog Number
      P4371
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Mouse CXCL12/SDF-1 Protein Summary

Description
A partial recombinant protein corresponding to the amino acids 22 - 93 of Mouse Cxcl12

Source: Escherichia coli

Amino Acid Sequence:KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM

Preparation
Method
Escherichia coli expression system
Details of Functionality
Determined by its ability to chemoattract human peripheral T cells activated with PHA and IL-2 using a concentration range of 5-40 ng/mL.
Protein/Peptide Type
Recombinant Protein
Gene
CXCL12

Applications/Dilutions

Application Notes
This product is useful for Func,SDS-PAGE.

Reactivity Notes

Mouse

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
Lyophilized from 2.5% glycine, 0.5% sucrose, 0.01% Tween 80, 5 mM Glutamic acid, pH 4.5
Preservative
No Preservative
Reconstitution Instructions
Reconstitute with deionized water to desired concentration.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Mouse CXCL12/SDF-1 Protein

  • chemokine (C-X-C motif) ligand 12
  • C-X-C motif chemokine 12
  • CXCL12
  • hIRH
  • hSDF-1
  • Intercrine reduced in hepatomas
  • IRH
  • PBSF
  • PBSFSDF-1a
  • Pre-B cell growth-stimulating factor
  • SCYB12
  • SDF1
  • SDF-1
  • SDF1A
  • SDF1B
  • SDF1SDF-1b
  • stromal cell-derived factor 1
  • TLSF
  • TLSF-a
  • TLSF-b
  • TPAR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24779
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P
366-6C/CF
Species: Hu
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF470
Species: Mu
Applications: WB, IHC, Neut
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-48337
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
P4371
Species: Mu
Applications: Func, PAGE

Publications for CXCL12/SDF-1 Recombinant Protein (P4371) (0)

There are no publications for CXCL12/SDF-1 Recombinant Protein (P4371).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCL12/SDF-1 Recombinant Protein (P4371) (0)

There are no reviews for CXCL12/SDF-1 Recombinant Protein (P4371). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CXCL12/SDF-1 Recombinant Protein (P4371) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CXCL12/SDF-1 Products

Bioinformatics Tool for CXCL12/SDF-1 Recombinant Protein (P4371)

Discover related pathways, diseases and genes to CXCL12/SDF-1 Recombinant Protein (P4371). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCL12/SDF-1 Recombinant Protein (P4371)

Discover more about diseases related to CXCL12/SDF-1 Recombinant Protein (P4371).
 

Pathways for CXCL12/SDF-1 Recombinant Protein (P4371)

View related products by pathway.

PTMs for CXCL12/SDF-1 Recombinant Protein (P4371)

Learn more about PTMs related to CXCL12/SDF-1 Recombinant Protein (P4371).
 

Research Areas for CXCL12/SDF-1 Recombinant Protein (P4371)

Find related products by research area.

Blogs on CXCL12/SDF-1

There are no specific blogs for CXCL12/SDF-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Mouse CXCL12/SDF-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCL12
Entrez