CX3CL1/Fractalkine Antibody (1D6)

Images

 
ELISA: CX3CL1/Fractalkine Antibody (1D6) [H00006376-M01] - Detection limit for recombinant GST tagged CX3CL1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CX3CL1/Fractalkine Antibody (1D6) Summary

Immunogen
CX3CL1 (AAH01163, 26 a.a. - 135 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGES
Specificity
CX3CL1 - chemokine (C-X3-C motif) ligand 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CX3CL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CX3CL1/Fractalkine Antibody (1D6)

  • ABCD-3
  • C3Xkine
  • chemokine (C-X3-C motif) ligand 1
  • CX3C membrane-anchored chemokine
  • CX3CL1
  • CXC3
  • CXC3C
  • FKN
  • Fractalkine
  • Neurotactin
  • neurotactin)
  • NTNsmall inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine
  • NTTSmall-inducible cytokine D1
  • SCYD1C-X3-C motif chemokine 1
  • small inducible cytokine subfamily D (Cys-X3-Cys), member-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76949
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
AF477
Species: Hu, Mu
Applications: WB, IHC, Block
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF482
Species: Mu
Applications: WB, IHC
H00006376-M01
Species: Hu
Applications: WB, ELISA

Publications for CX3CL1/Fractalkine Antibody (H00006376-M01) (0)

There are no publications for CX3CL1/Fractalkine Antibody (H00006376-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CX3CL1/Fractalkine Antibody (H00006376-M01) (0)

There are no reviews for CX3CL1/Fractalkine Antibody (H00006376-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CX3CL1/Fractalkine Antibody (H00006376-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CX3CL1/Fractalkine Products

Bioinformatics Tool for CX3CL1/Fractalkine Antibody (H00006376-M01)

Discover related pathways, diseases and genes to CX3CL1/Fractalkine Antibody (H00006376-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CX3CL1/Fractalkine Antibody (H00006376-M01)

Discover more about diseases related to CX3CL1/Fractalkine Antibody (H00006376-M01).
 

Pathways for CX3CL1/Fractalkine Antibody (H00006376-M01)

View related products by pathway.

PTMs for CX3CL1/Fractalkine Antibody (H00006376-M01)

Learn more about PTMs related to CX3CL1/Fractalkine Antibody (H00006376-M01).
 

Research Areas for CX3CL1/Fractalkine Antibody (H00006376-M01)

Find related products by research area.

Blogs on CX3CL1/Fractalkine

There are no specific blogs for CX3CL1/Fractalkine, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CX3CL1/Fractalkine Antibody (1D6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CX3CL1
Entrez
OMIM
Uniprot