Recombinant Human CUZD1 GST (N-Term) Protein

Western Blot: Recombinant Human CUZD1 Protein [H00050624-Q01] - CUZD1 Partial Recombinant Protein [H00050624-Q01] - analysis of SKBR3 cell (left) and CUZD1 partial recombinant protein (right) using anti-CUZD1 antibody (Cat.# 44900002). Image from verified customer review.

SDS-Page: Recombinant Human CUZD1 Protein [H00050624-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human CUZD1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 471-570 of Human CUZD1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: YPLFGHYGRFQFNAFKFLRSMSSVYLQCKVLICDSSDHQSRCNQGCVSRSKRDISSYKWKTDSIIGPIRLKRDRSASGNSGFQHETHAEETPNQPFNSVH

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: CUZD1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CUZD1 GST (N-Term) Protein

• CUB and zona pellucida-like domain-containing protein 1
• CUB and zona pellucida-like domains 1
• CUB and ZP domain-containing protein 1
• ERG-1
• estrogen regulated gene 1
• Transmembrane protein UO-44
• UO-44

Background

CUZD1 - CUB and zona pellucida-like domains 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Review for CUZD1 Partial Recombinant Protein (H00050624-Q01) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Ming Lu WB Human 10/09/2014

Summary

• Application: Western Blot
• Sample Tested: Human breast cancer cell line SKBR3 and this product
• Species: Human
• Lot: E9051

Bioinformatics

• Gene Symbol: CUZD1