CTNNAL1 Antibody (2A2)

Images

 

Product Details

Summary
Product Discontinued
View other related CTNNAL1 Primary Antibodies

Order Details


    • Catalog Number
      H00008727-M06
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CTNNAL1 Antibody (2A2) Summary

Immunogen
CTNNAL1 (NP_003789 277 a.a. - 380 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TDCKPNGETDISSISIFTGIKEFKMNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQLISVWIQAQSKKTKSIAEELE
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CTNNAL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CTNNAL1 Antibody (2A2)

  • ACRP
  • alpha2-catulin
  • Alpha-catenin-related protein
  • alpha-CATU
  • alpha-catulin
  • catenin (cadherin-associated protein), alpha-like 1
  • Catenin alpha-like protein 1
  • CLLP
  • FLJ08121

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-97719
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
H00001496-B01P
Species: Hu, Rt
Applications: WB
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for CTNNAL1 Antibody (H00008727-M06) (0)

There are no publications for CTNNAL1 Antibody (H00008727-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTNNAL1 Antibody (H00008727-M06) (0)

There are no reviews for CTNNAL1 Antibody (H00008727-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CTNNAL1 Antibody (H00008727-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTNNAL1 Products

Bioinformatics Tool for CTNNAL1 Antibody (H00008727-M06)

Discover related pathways, diseases and genes to CTNNAL1 Antibody (H00008727-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTNNAL1 Antibody (H00008727-M06)

Discover more about diseases related to CTNNAL1 Antibody (H00008727-M06).
 

Pathways for CTNNAL1 Antibody (H00008727-M06)

View related products by pathway.

PTMs for CTNNAL1 Antibody (H00008727-M06)

Learn more about PTMs related to CTNNAL1 Antibody (H00008727-M06).
 

Research Areas for CTNNAL1 Antibody (H00008727-M06)

Find related products by research area.

Blogs on CTNNAL1

There are no specific blogs for CTNNAL1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTNNAL1 Antibody (2A2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNNAL1
Uniprot