CTHRC1 Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

CTHRC1 Recombinant Protein Summary

Description
CTHRC1 (Human) GST-Tagged Recombinant Protein (P01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Gene
CTHRC1

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CTHRC1 Recombinant Protein

  • collagen triple helix repeat containing 1
  • collagen triple helix repeat-containing protein 1
  • CTHRC1
  • NMTC1
  • Protein NMTC1

Background

CTHRC1 is specifically expressed in vascular calcifications of carotid artery lesions and may contribute to vascular remodeling of injured arteries (Pyagay et al., 2005 [PubMed 15618538]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00053630-Q01
Species: Hu
AF3149
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-1514
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, PEP-ELISA
AF2064
Species: Hu
Applications: WB, Simple Western
NB600-594
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF6278
Species: Hu, Mu
Applications: WB
NBP2-24519
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB
AF7164
Species: Hu
Applications: WB
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
H00115908-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CTHRC1 Recombinant Protein (H00115908-P01) (0)

There are no publications for CTHRC1 Recombinant Protein (H00115908-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTHRC1 Recombinant Protein (H00115908-P01) (0)

There are no reviews for CTHRC1 Recombinant Protein (H00115908-P01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTHRC1 Recombinant Protein (H00115908-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CTHRC1 Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for CTHRC1 Recombinant Protein (H00115908-P01)

Discover related pathways, diseases and genes to CTHRC1 Recombinant Protein (H00115908-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTHRC1 Recombinant Protein (H00115908-P01)

Discover more about diseases related to CTHRC1 Recombinant Protein (H00115908-P01).
 

Pathways for CTHRC1 Recombinant Protein (H00115908-P01)

View related products by pathway.

PTMs for CTHRC1 Recombinant Protein (H00115908-P01)

Learn more about PTMs related to CTHRC1 Recombinant Protein (H00115908-P01).

Blogs on CTHRC1

There are no specific blogs for CTHRC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our CTHRC1 Recombinant Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CTHRC1
Entrez
Uniprot

Customers Who Bought This Also Bought