CSTF3 Antibody (1D4) [DyLight 405LS]

Images

 

Product Details

Summary
Product Discontinued
View other related CSTF3 Primary Antibodies

Order Details


    • Catalog Number
      H00001479-M01V3
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CSTF3 Antibody (1D4) [DyLight 405LS] Summary

Immunogen
CSTF3 (AAH09792, 1 a.a. - 103 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
Localization
Nuclear
Specificity
CSTF3 - cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSTF3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CSTF3 Antibody (1D4) [DyLight 405LS]

  • CF-1 77 kDa subunit
  • Cleavage stimulation factor 77 kDa subunit
  • cleavage stimulation factor subunit 3
  • cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kD
  • cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
  • CSTF 77 kDa subunit
  • CSTF-77
  • MGC117398
  • MGC43001
  • MGC75122

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87407
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-60443
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74592
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-74614
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP2-38854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24696
Species: Hu
Applications: IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-58854
Species: Hu
Applications: ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00499
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB4218
Species: Hu
Applications: WB, IHC
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CSTF3 Antibody (H00001479-M01V3) (0)

There are no publications for CSTF3 Antibody (H00001479-M01V3).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSTF3 Antibody (H00001479-M01V3) (0)

There are no reviews for CSTF3 Antibody (H00001479-M01V3). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CSTF3 Antibody (H00001479-M01V3) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CSTF3 Products

Bioinformatics Tool for CSTF3 Antibody (H00001479-M01V3)

Discover related pathways, diseases and genes to CSTF3 Antibody (H00001479-M01V3). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSTF3 Antibody (H00001479-M01V3)

Discover more about diseases related to CSTF3 Antibody (H00001479-M01V3).
 

Pathways for CSTF3 Antibody (H00001479-M01V3)

View related products by pathway.

Blogs on CSTF3

There are no specific blogs for CSTF3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSTF3 Antibody (1D4) [DyLight 405LS] and receive a gift card or discount.

Bioinformatics

Gene Symbol CSTF3