CSRP2 Antibody

Images

 
Western Blot: CSRP2 Antibody [NBP1-74136] - Mouse Pancreas Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Product Discontinued
View other related CSRP2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74136
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CSRP2 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Csrp2. Immunizing peptide sequence IKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPW.
Clonality
Polyclonal
Host
Rabbit
Gene
CSRP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Csrp2 and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CSRP2 Antibody

  • CRP2
  • CRP2LIM domain only protein 5
  • CSRP2
  • cysteine and glycine-rich protein 2
  • Cysteine-rich protein 2
  • LMO5LMO-5
  • SmLIM
  • SmLIMLIM domain only 5, smooth muscle
  • Smooth muscle cell LIM protein

Background

Csrp2 is drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. It seems to play a role in the development of the embryonic vascular system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-84380
Species: Hu
Applications: IHC, IHC-P
NBP1-85446
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
NBP1-88762
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84379
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP1-74136
Species: Mu
Applications: WB

Publications for CSRP2 Antibody (NBP1-74136) (0)

There are no publications for CSRP2 Antibody (NBP1-74136).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSRP2 Antibody (NBP1-74136) (0)

There are no reviews for CSRP2 Antibody (NBP1-74136). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSRP2 Antibody (NBP1-74136) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CSRP2 Products

Bioinformatics Tool for CSRP2 Antibody (NBP1-74136)

Discover related pathways, diseases and genes to CSRP2 Antibody (NBP1-74136). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSRP2 Antibody (NBP1-74136)

Discover more about diseases related to CSRP2 Antibody (NBP1-74136).
 

Pathways for CSRP2 Antibody (NBP1-74136)

View related products by pathway.

PTMs for CSRP2 Antibody (NBP1-74136)

Learn more about PTMs related to CSRP2 Antibody (NBP1-74136).

Blogs on CSRP2

There are no specific blogs for CSRP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSRP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSRP2
Entrez
Uniprot