CSRP1 Antibody (2A11) [DyLight 405LS]

Images

 

Product Details

Summary
Product Discontinued
View other related CSRP1 Primary Antibodies

Order Details


    • Catalog Number
      H00001465-M06V3
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CSRP1 Antibody (2A11) [DyLight 405LS] Summary

Immunogen
CSRP1 (NP_004069, 94 a.a. - 192 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHS
Specificity
CSRP1 - cysteine and glycine-rich protein 1 (2A11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSRP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CSRP1 Antibody (2A11) [DyLight 405LS]

  • CRP
  • CRP1
  • CSRP1
  • CSRPCYRP
  • CYRP
  • cysteine and glycine-rich protein 1
  • Cysteine-rich protein 1
  • D1S181E
  • DKFZp686M148
  • LIM-domain protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF4409
Species: Mu
Applications: WB
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CSRP1 Antibody (H00001465-M06V3) (0)

There are no publications for CSRP1 Antibody (H00001465-M06V3).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSRP1 Antibody (H00001465-M06V3) (0)

There are no reviews for CSRP1 Antibody (H00001465-M06V3). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CSRP1 Antibody (H00001465-M06V3) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CSRP1 Products

Bioinformatics Tool for CSRP1 Antibody (H00001465-M06V3)

Discover related pathways, diseases and genes to CSRP1 Antibody (H00001465-M06V3). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSRP1 Antibody (H00001465-M06V3)

Discover more about diseases related to CSRP1 Antibody (H00001465-M06V3).
 

Pathways for CSRP1 Antibody (H00001465-M06V3)

View related products by pathway.

PTMs for CSRP1 Antibody (H00001465-M06V3)

Learn more about PTMs related to CSRP1 Antibody (H00001465-M06V3).

Blogs on CSRP1

There are no specific blogs for CSRP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSRP1 Antibody (2A11) [DyLight 405LS] and receive a gift card or discount.

Bioinformatics

Gene Symbol CSRP1
Entrez