Recombinant Human CRYGS Protein

Images

 

Product Details

Summary
Product Discontinued
View other related CRYGS Peptides and Proteins

Order Details


    • Catalog Number
      H00001427-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CRYGS Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-178 of Human CRYGS full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CRYGS

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
47.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CRYGS Protein

  • beta-crystallin S
  • CRYG8
  • crystallin, gamma 8
  • crystallin, gamma S
  • Gamma-crystallin S
  • gamma-S-crystallin
  • GRYG8

Background

Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. This gene encodes a protein initially considered to be a beta-crystallin but the encoded protein is monomeric and has greater sequence similarity to other gamma-crystallins. This gene encodes the most significant gamma-crystallin in adult eye lens tissue. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

31310002
Species: Hu
Applications: WB, ELISA
NBP2-46354
Species: Hu
Applications: WB, IHC, IF
NBP1-32557
Species: Hu
Applications: WB
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33010
Species: Mu
Applications: WB
H00001415-M02
Species: Hu
Applications: WB, ELISA
H00001414-M03
Species: Hu
Applications: WB, ELISA
NBP1-32741
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-49196
Species: Hu
Applications: IHC
NBP2-58660
Species: Hu
Applications: IHC-P
NBP2-07779
Species: Hu
MAB5695
Species: Hu, Mu
Applications: WB
NBP2-58661
Species: Hu
Applications: IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00001412-B02P
Species: Hu
Applications: WB
NBP2-46573
Species: Hu
Applications: WB, IHC
NBP2-46572
Species: Hu
Applications: WB, IHC
NBP1-62297
Species: Hu
Applications: WB

Publications for CRYGS Recombinant Protein (H00001427-P01) (0)

There are no publications for CRYGS Recombinant Protein (H00001427-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRYGS Recombinant Protein (H00001427-P01) (0)

There are no reviews for CRYGS Recombinant Protein (H00001427-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRYGS Recombinant Protein (H00001427-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRYGS Products

Bioinformatics Tool for CRYGS Recombinant Protein (H00001427-P01)

Discover related pathways, diseases and genes to CRYGS Recombinant Protein (H00001427-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRYGS Recombinant Protein (H00001427-P01)

Discover more about diseases related to CRYGS Recombinant Protein (H00001427-P01).
 

Pathways for CRYGS Recombinant Protein (H00001427-P01)

View related products by pathway.

PTMs for CRYGS Recombinant Protein (H00001427-P01)

Learn more about PTMs related to CRYGS Recombinant Protein (H00001427-P01).

Blogs on CRYGS

There are no specific blogs for CRYGS, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CRYGS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYGS