CRY1 Antibody (4H4-1C4) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related CRY1 Primary Antibodies

Order Details


    • Catalog Number
      H00001407-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CRY1 Antibody (4H4-1C4) [DyLight 488] Summary

Immunogen
CRY1 (AAH30519, 1 a.a. - 586 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
Localization
Cytoplasmic and Nuclear.
Specificity
CRY1 - cryptochrome 1 (photolyase-like)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRY1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRY1 Antibody (4H4-1C4) [DyLight 488]

  • CRY1
  • cryptochrome 1 (photolyase-like)
  • Cryptochrome I
  • PHLL1
  • PHLL1cryptochrome-1
  • photolyase-like cryptochrome 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-125
Species: Hu
Applications: WB, ICC/IF
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
H00008863-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00004867-D01P
Species: Hu, Mu
Applications: WB
AF4208
Species: Rt
Applications: WB
NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP

Publications for Cryptochrome I Antibody (H00001407-M01G) (0)

There are no publications for Cryptochrome I Antibody (H00001407-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cryptochrome I Antibody (H00001407-M01G) (0)

There are no reviews for Cryptochrome I Antibody (H00001407-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cryptochrome I Antibody (H00001407-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRY1 Products

Bioinformatics Tool for Cryptochrome I Antibody (H00001407-M01G)

Discover related pathways, diseases and genes to Cryptochrome I Antibody (H00001407-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cryptochrome I Antibody (H00001407-M01G)

Discover more about diseases related to Cryptochrome I Antibody (H00001407-M01G).
 

Pathways for Cryptochrome I Antibody (H00001407-M01G)

View related products by pathway.

PTMs for Cryptochrome I Antibody (H00001407-M01G)

Learn more about PTMs related to Cryptochrome I Antibody (H00001407-M01G).
 

Research Areas for Cryptochrome I Antibody (H00001407-M01G)

Find related products by research area.

Blogs on CRY1

There are no specific blogs for CRY1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRY1 Antibody (4H4-1C4) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol CRY1
Entrez