CRTAM Antibody

Images

 
Western Blot: CRTAM Antibody [NBP2-31019] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry: CRTAM Antibody [NBP2-31019] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRTAM Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRTAM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CRTAM Protein (NBP2-31019PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRTAM Antibody

  • CD355 antigen
  • CD355
  • class I MHC restricted T cell associated molecule
  • class-I MHC-restricted T cell associated molecule
  • Class-I MHC-restricted T-cell-associated molecule
  • CRTAM
  • cytotoxic and regulatory T cell molecule
  • cytotoxic and regulatory T-cell molecule

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-186
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB19081
Species: Hu
Applications: Flow, CyTOF-ready
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
MAB2048
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2426
Species: Hu
Applications: WB, IHC
AF144
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-84703
Species: Hu
Applications: IHC, IHC-P
AF3126
Species: Hu
Applications: Flow, CyTOF-ready
MAB689
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB1187
Species: Mu
Applications: WB, Flow, AgAct, CyTOF-ready, ICC
NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2944
Species: Hu
Applications: WB, Simple Western
NBP2-31019
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CRTAM Antibody (NBP2-31019) (0)

There are no publications for CRTAM Antibody (NBP2-31019).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRTAM Antibody (NBP2-31019) (0)

There are no reviews for CRTAM Antibody (NBP2-31019). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRTAM Antibody (NBP2-31019) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRTAM Products

Bioinformatics Tool for CRTAM Antibody (NBP2-31019)

Discover related pathways, diseases and genes to CRTAM Antibody (NBP2-31019). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRTAM Antibody (NBP2-31019)

Discover more about diseases related to CRTAM Antibody (NBP2-31019).
 

Pathways for CRTAM Antibody (NBP2-31019)

View related products by pathway.

PTMs for CRTAM Antibody (NBP2-31019)

Learn more about PTMs related to CRTAM Antibody (NBP2-31019).

Blogs on CRTAM

There are no specific blogs for CRTAM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRTAM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRTAM
Entrez
Uniprot