CrkL Antibody (4B5) [Alexa Fluor® 647]

Images

 

Product Details

Summary
Product Discontinued
View other related CrkL Primary Antibodies

Order Details


    • Catalog Number
      H00001399-M03AF647
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CrkL Antibody (4B5) [Alexa Fluor® 647] Summary

Immunogen
CRKL (NP_005198 204 a.a. - 303 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
Specificity
CRKL (4B5)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRKL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for CrkL Antibody (4B5) [Alexa Fluor® 647]

  • CrkL
  • crk-like protein
  • v-crk avian sarcoma virus CT10 oncogene homolog-like
  • v-crk sarcoma virus CT10 oncogene homolog (avian)-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-49154
Species: Hu
Applications: IHC
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-45515
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001399-M03AF647
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA

Publications for CrkL Antibody (H00001399-M03AF647) (0)

There are no publications for CrkL Antibody (H00001399-M03AF647).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CrkL Antibody (H00001399-M03AF647) (0)

There are no reviews for CrkL Antibody (H00001399-M03AF647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CrkL Antibody (H00001399-M03AF647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CrkL Products

Bioinformatics Tool for CrkL Antibody (H00001399-M03AF647)

Discover related pathways, diseases and genes to CrkL Antibody (H00001399-M03AF647). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CrkL Antibody (H00001399-M03AF647)

Discover more about diseases related to CrkL Antibody (H00001399-M03AF647).
 

Pathways for CrkL Antibody (H00001399-M03AF647)

View related products by pathway.

PTMs for CrkL Antibody (H00001399-M03AF647)

Learn more about PTMs related to CrkL Antibody (H00001399-M03AF647).
 

Research Areas for CrkL Antibody (H00001399-M03AF647)

Find related products by research area.

Blogs on CrkL

There are no specific blogs for CrkL, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CrkL Antibody (4B5) [Alexa Fluor® 647] and receive a gift card or discount.

Bioinformatics

Gene Symbol CRKL
Entrez