CREM Antibody (3B5) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related CREM Primary Antibodies

Order Details


    • Catalog Number
      H00001390-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CREM Antibody (3B5) [DyLight 488] Summary

Immunogen
CREM (NP_853549 201 a.a. - 300 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY
Specificity
CREM (3B5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CREM
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CREM Antibody (3B5) [DyLight 488]

  • cAMP response element modulator
  • cAMP responsive element modulator
  • cAMP-responsive element modulator
  • hCREM 2alpha-b protein
  • hCREM 2beta-a protein
  • hCREM-2
  • ICER
  • inducible cAMP early repressor ICER
  • Inducible cAMP early repressor
  • MGC111110
  • MGC17881
  • MGC41893

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
H00009457-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00001390-M02G
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for CREM Antibody (H00001390-M02G) (0)

There are no publications for CREM Antibody (H00001390-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREM Antibody (H00001390-M02G) (0)

There are no reviews for CREM Antibody (H00001390-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CREM Antibody (H00001390-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CREM Products

Bioinformatics Tool for CREM Antibody (H00001390-M02G)

Discover related pathways, diseases and genes to CREM Antibody (H00001390-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREM Antibody (H00001390-M02G)

Discover more about diseases related to CREM Antibody (H00001390-M02G).
 

Pathways for CREM Antibody (H00001390-M02G)

View related products by pathway.

PTMs for CREM Antibody (H00001390-M02G)

Learn more about PTMs related to CREM Antibody (H00001390-M02G).
 

Research Areas for CREM Antibody (H00001390-M02G)

Find related products by research area.

Blogs on CREM

There are no specific blogs for CREM, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CREM Antibody (3B5) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol CREM