Recombinant Human CREB3L2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related CREB3L2 Peptides and Proteins

Order Details


    • Catalog Number
      H00064764-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CREB3L2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 421-518 of Human CREB3L2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNT

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
CREB3L2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CREB3L2 Protein

  • basic transcription factor 2
  • BBF2 human homolog on chromosome 7
  • BBF2H7TCAG_1951439
  • B-ZIB transcription factor
  • cAMP responsive element binding protein 3-like 2
  • cAMP-responsive element-binding protein 3-like protein 2
  • cyclic AMP-responsive element-binding protein 3-like protein 2
  • FUS/BBF2H7 protein
  • MGC131709
  • MGC71006

Background

CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82503
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-1015
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
H00010488-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-34842
Species: Hu, Mu, Rt, Ha
Applications: WB, Flow, ICC/IF, IP
NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-16008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-89435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB391
Species: Hu, Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF1310
Species: Hu
Applications: WB, IHC, IP

Publications for CREB3L2 Partial Recombinant Protein (H00064764-Q01) (0)

There are no publications for CREB3L2 Partial Recombinant Protein (H00064764-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREB3L2 Partial Recombinant Protein (H00064764-Q01) (0)

There are no reviews for CREB3L2 Partial Recombinant Protein (H00064764-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CREB3L2 Partial Recombinant Protein (H00064764-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CREB3L2 Products

Bioinformatics Tool for CREB3L2 Partial Recombinant Protein (H00064764-Q01)

Discover related pathways, diseases and genes to CREB3L2 Partial Recombinant Protein (H00064764-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREB3L2 Partial Recombinant Protein (H00064764-Q01)

Discover more about diseases related to CREB3L2 Partial Recombinant Protein (H00064764-Q01).
 

Pathways for CREB3L2 Partial Recombinant Protein (H00064764-Q01)

View related products by pathway.

PTMs for CREB3L2 Partial Recombinant Protein (H00064764-Q01)

Learn more about PTMs related to CREB3L2 Partial Recombinant Protein (H00064764-Q01).

Blogs on CREB3L2

There are no specific blogs for CREB3L2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CREB3L2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CREB3L2