CREB Antibody (2B2)

Images

 
Western Blot: CREB Antibody (2B2) [H00001385-M08] - Analysis of CREB1 expression in transfected 293T cell line by CREB1 monoclonal antibody (M08), clone 2B2. Lane 1: CREB1 transfected lysatE (35.1 KDa). Lane 2: ...read more
ELISA: CREB Antibody (2B2) [H00001385-M08] - Detection limit for recombinant GST tagged CREB1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CREB Antibody (2B2) Summary

Immunogen
CREB1 (AAH10636.1, 14 a.a. - 101 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQ
Specificity
CREB1 - cAMP responsive element binding protein 1 (2B2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CREB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CREB Antibody (2B2)

  • active transcription factor CREB
  • cAMP responsive element binding protein 1
  • cAMP-response element-binding protein-1
  • cAMP-responsive element-binding protein 1
  • CREB
  • CREB1
  • CREB-1
  • cyclic AMP-responsive element-binding protein 1
  • MGC9284
  • transactivator protein

Background

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF1310
Species: Hu
Applications: WB, IHC, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
H00001385-M08
Species: Hu
Applications: WB, ELISA

Publications for CREB Antibody (H00001385-M08) (0)

There are no publications for CREB Antibody (H00001385-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREB Antibody (H00001385-M08) (0)

There are no reviews for CREB Antibody (H00001385-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CREB Antibody (H00001385-M08). (Showing 1 - 1 of 1 FAQ).

  1. May I know which creb1 antibody is good for ChIP? I found a paper using your rabbit polyclonal creb1 antibody for ChIP but they didn't indicate the catalog number.
    • We are not aware of any of our Creb1 antibodies being used in ChIP at this time. If you can provide us with the PMID of the paper you are referring to I can contact the author. Otherwise, you can use our Innovators Reward Program to try an antibody in a novel species and application.

Secondary Antibodies

 

Isotype Controls

Additional CREB Products

Bioinformatics Tool for CREB Antibody (H00001385-M08)

Discover related pathways, diseases and genes to CREB Antibody (H00001385-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREB Antibody (H00001385-M08)

Discover more about diseases related to CREB Antibody (H00001385-M08).
 

Pathways for CREB Antibody (H00001385-M08)

View related products by pathway.

PTMs for CREB Antibody (H00001385-M08)

Learn more about PTMs related to CREB Antibody (H00001385-M08).
 

Research Areas for CREB Antibody (H00001385-M08)

Find related products by research area.

Blogs on CREB.

Exploring the Many Roles of PGC-1 alpha
The peroxisome proliferator-activated receptor gamma, co-activator 1 (PGC-1 alpha or PPARGC1A) gene encodes a 91 kDa nuclear protein that acts as a transcriptional co-activator involved in energy metabolism. Interaction with PPAR gamma allows it to in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CREB Antibody (2B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CREB1
Entrez
Uniprot